Analytical Data
-
Gene name
BMI1
-
简介
BMI1 Protein, a component of the Polycomb group PRC1-like complex, maintains transcriptional repression in genes, including Hox genes, by monoubiquitinating histone H2A. It regulates the E3 ubiquitin-protein ligase activity of RNF2/RING2. Interacts with various partners in the PRC1-like complex, such as RNF2, CBX2, CBX4, CBX8, PHC1, PHC2, PHC3, and UB2D3, forming complexes crucial for chromatin modification and gene expression control. BMI1 Protein, Human (E.coli,N-His) is the recombinant human-derived BMI1 protein, expressed by E. coli , with N-6*His labeled tag.
- Application
-
Alternative Names
ELAV1; Hua; HUR; MelG
-
Species
Human
-
Source
E. coli
-
Tag
N-6*His
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P35226
-
Expression Region
M1-G326
-
AA Sequence
MHRTTRIKITELNPHLMCVLCGGYFIDATTIIECLHSFCKTCIVRYLETSKYCPICDVQVHKTRPLLNIRSDKTLQDIVYKLVPGLFKNEMKRRRDFYAAHPSADAANGSNEDRGEVADEDKRIITDDEIISLSIEFFDQNRLDRKVNKDKEKSKEEVNDKRYLRCPAAMTVMHLRKFLRSKMDIPNTFQIDVMYEEEPLKDYYTLMDIAYIYTWRRNGPLPLKYRVRPTCKRMKISHQRDGLTNAGELESDSGSDKANSPAGGIPSTSSCLPSPSTPVQSPHPQFPHISSTMNGTSNSPSGNHQSSFANRPRKSSVNGSSATSSG
-
Protein Length
Full Length
-
Molecular Weight
43 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
BMI1 (B lymphoma Mo-MLV insertion region 1) is a vital component of the Polycomb Repressive Complex 1 (PRC1), which plays a crucial role in gene silencing and stem cell maintenance. Its overexpression has been linked to various cancers, as it facilitates tumorigenesis by promoting cellular proliferation and inhibiting apoptosis. Researchers have identified BMI1 as a promising target for cancer therapy due to its pivotal role in maintaining cancer stem cell properties, making it a critical area of study in oncology. Recent efforts have focused on the characterization of recombinant BMI1 proteins to elucidate their structural and functional properties. These recombinant proteins enable researchers to better understand BMI1's molecular mechanisms and its interactions with other cellular components, paving the way for potential therapeutic interventions. Moreover, studies on BMI1 may uncover its role in normal developmental processes and its aberrant functions in malignant transformation, providing insights into the broader implications of Polycomb group proteins in health and disease. Given its involvement in critical cellular functions and its potential as a therapeutic target, BMI1 continues to be an area of intense investigation within molecular biology and cancer research.
