Cat: IPD-X50482

Recombinant Human PDPK1 Protein , N-His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    PDPK1

  • 简介

    PDPK1 protein is the core kinase of the AGC family and can phosphorylate and activate various downstream kinases, including PKB/AKT1, RPS6KB1, PRKACA, PRKCD, SGK1, PAK1 and PKN. It transduces insulin signals and regulates cellular processes such as proliferation, survival, and nutrient absorption. PDPK1 Protein, Human (sf9, His) is the recombinant human-derived PDPK1 protein, expressed by sf9 insect cells , with N-8*His labeled tag.

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    PDPK1; 3-phosphoinositide-dependent protein kinase 1; hPDK1

  • Species

    Human

  • Source

    Sf9 insect cells

  • Tag

    N-8*His

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    O15530

  • Expression Region

    51-360aa

  • AA Sequence

    MDGTAAEPRPGAGSLQHAQPPPQPRKKRPEDFKFGKILGEGSFSTVVLARELATSREYAIKILEKRHIIKENKVPYVTRERDVMSRLDHPFFVKLYFTFQDDEKLYFGLSYAKNGELLKYIRKIGSFDETCTRFYTAEIVSALEYLHGKGIIHRDLKPENILLNEDMHIQITDFGTAKVLSPESKQARANSFVGTAQYVSPELLTEKSACKSSDLWALGCIIYQLVAGLPPFRAGNEYLIFQKIIKLEYDFPEKFFPKARDLVEKLLVLDATKRLGCEEMEGYGPLKAHPFFESVTWENLHQQTPPKLTA

  • Protein Length

    Partial

  • Molecular Weight

    37.6 KDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

PDPK1, or 3-phosphoinositide-dependent protein kinase-1, is a pivotal regulator in various cellular processes, especially in the context of the phosphoinositide signaling pathway. This kinase primarily activates AGC (PKA, PKG, and PKC) family kinases, thereby influencing cell growth, survival, and metabolism. Dysregulation of PDPK1 activity has been implicated in various diseases, including cancer and metabolic disorders, making it a critical target for therapeutic research. With advances in protein engineering techniques, the recombinant expression of PDPK1 has gained attention, enabling detailed investigation of its structure, function, and regulatory mechanisms. Understanding the biophysical properties and enzymatic activities of recombinant PDPK1 can shed light on its role in signal transduction and contribute to the development of innovative strategies for treatment interventions. Thus, the study of recombinant PDPK1 not only enhances our fundamental understanding of cellular signaling but also paves the way for potential clinical applications in disease management.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US