Analytical Data
-
Gene name
GATA1
- Application
-
Alternative Names
ERYF1; GF1; NFE1; GlobinTranscription Factor 1; Erythroidtranscription factor; ; NF-E1 DNA-binding protein
-
Species
Human
-
Source
E. coli
-
Tag
N-terminal His Tag
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P15976
-
Expression Region
150-341aa
-
AA Sequence
LSPDLLTLGPALPSSLPVPNSAYGGPDFSSTFFSPTGSPLNSAAYSSPKLRGTL PLPPCEARECVNCGATATPLWRRDRTGHYLCNACGLYHKMNGQNRPLIRPKKRL IVSKRAGTQCTNCQTTTTTLWRRNASGDPVCNACGLYYKLHQVNRPLTMRKDGI QTRNRKASGKGKKKRGSSLGGTGAAEGPAGGFMVVAGGS
-
Molecular Weight
24.1kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Identification
Protein Description
GATA1 is a crucial transcription factor that plays a significant role in erythroid differentiation and other hematopoietic processes. It is part of the GATA family of zinc-finger proteins and is primarily expressed in erythroid cells, megakaryocytes, and certain neurons. Mutations or dysregulation of GATA1 are associated with various hematological disorders, including anemia and thrombocytopenia, as well as congenital conditions such as Down syndrome. Understanding the structure and function of GATA1 is vital for elucidating its role in gene regulation and the development of blood cells. The study of GATA1 recombinant proteins enables researchers to investigate its binding affinity to DNA, protein-protein interactions, and the impact of specific mutations on its activity. Recombinant GATA1 proteins can be utilized in various assays, including electrophoretic mobility shift assays (EMSAs), reporter gene assays, and co-immunoprecipitation studies, providing insights into its functional mechanisms. Furthermore, the development of recombinant GATA1 proteins facilitates the design of potential therapeutic strategies and contributes to advancing our understanding of blood-related diseases, making it a valuable focus area in biomedical research. By generating and characterizing GATA1 recombinant proteins, researchers aim to bridge the gap between basic biological functions and clinical applications, ultimately contributing to improved diagnostic and therapeutic options for patients with GATA1-related disorders.
