Analytical Data
-
Gene name
NTRK2
- Application
-
Alternative Names
NTRK2；TRKB；BDNF/NT-3 growth factors receptor
-
Species
Mouse
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P15209
-
Expression Region
39-249 aa
-
AA Sequence
SSARIWCTEPSPGIVAFPRLEPNSVDPENITEILIANQKRLEIINEDDVEAYVGLRNLTIVDSGLKFVAYKAFLKNSNLRHINFTRNKLTSLSRRHFRHLDLSDLILTGNPFTCSCDIMWLKTLQETKSSPDTQDLYCLNESSKNMPLANLQIPNCGLPSARLAAPNLTVEEGKSVTLSCSVGGDPLPTLYWDVGNLVSKHMNETSHTQGS
-
Molecular Weight
23.2 KDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Identification
Protein Description
NTRK2, also known as neurotrophic tyrosine receptor kinase 2, is a critical gene that encodes a receptor for neurotrophins such as brain-derived neurotrophic factor (BDNF). It plays a significant role in neuronal development, survival, and synaptic plasticity, implicating it in various neurological disorders, including depression and neurodegenerative diseases. The research surrounding NTRK2 recombinant proteins has gained momentum due to their potential therapeutic applications, particularly in targeted treatments for cancer. NTRK gene fusions have been identified in several tumor types, leading to the development of NTRK inhibitors that aim to halt tumor growth by interfering with the aberrant signaling pathways activated by these fusions. Furthermore, characterizing NTRK2 recombinant proteins enhances our understanding of its functional properties and cellular mechanisms, paving the way for innovative treatment strategies. The study of NTRK2 also extends to its implications in mental health, as alterations in its signaling pathways have been linked to mood disorders. Researchers are keen to explore the differential expression of NTRK2 and its variants, which may serve as biomarkers for disease progression and treatment responsiveness. As a result, NTRK2 recombinant protein studies are integral to advancing our knowledge of both oncological and neurobiological contexts, holding promise for future therapeutic developments that could significantly improve patient outcomes in these challenging fields.
