Analytical Data
-
Gene name
DCTD
- Application
-
Alternative Names
DCTD;Deoxycytidylate deaminase
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P32321
-
Expression Region
1-178aa
-
AA Sequence
MGSSHHHHHHSSGLVPRGSHMSEVSCKKRDDYLEWPEYFMAVAFLSAQRS KDPNSQVGACIVNSENKIVGIGYNGMPNGCSDDVLPWRRTAENKLDTKYP YVCHAELNAIMNKNSTDVKGCSMYVALFPCNECAKLIIQAGIKEVIFMSD KYHDSDEATAARLLFNMAGVTFRKFIPKCSKIVIDFDSINSRPSQKLQ
-
Molecular Weight
22 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
DCTD (deoxycytidine triphosphate diphosphohydrolase) is an essential enzyme involved in nucleotide metabolism, specifically in the hydrolysis of dCTP to dCDP and inorganic phosphate. This enzymatic reaction is crucial for maintaining the balance of deoxynucleotides within the cell, which is vital for DNA synthesis and repair pathways. Dysregulation of DCTD has been implicated in various diseases, including cancer, as altered nucleotide pools can lead to genomic instability. Understanding the structure and function of DCTD, as well as the mechanisms governing its activity, may provide insights for therapeutic interventions. Research on recombinant DCTD proteins offers a valuable avenue for characterizing the enzyme’s biochemical properties, elucidating its role in nucleotide metabolism, and exploring potential applications in drug development. By generating and studying DCTD in a controlled laboratory setting, scientists can investigate its interactions with other biomolecules, assess the impact of mutations, and identify small-molecule inhibitors that could modulate its activity. This research not only contributes to the fundamental understanding of cellular metabolism but also opens up possibilities for innovative approaches to treat diseases associated with nucleotide imbalances.
