Analytical Data
-
Gene name
CNKSR2
- Application
-
Alternative Names
CNKSR2;CNK2;KIAA0902;KSR2;Connector enhancer of kinase suppressor of ras 2
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q8WXI2
-
Expression Region
650-800aa
-
AA Sequence
AAEHLDDMNRWLNRINMLTAGYAERERIKQEQDYWSESDKEEADTPSTPKQDSPPPPYDTYPRPPSMSCASPYVEAKHSRLSSTETSQSQSSHEEFRQEVTGSSAVSPIRKTASQRRSWQDLIETPLTSSGLHYLQTLPLEDSVFSDSAAI
-
Molecular Weight
19.1 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
CNKSR2 (Connector Enhancer of Kinase Suppressor of Ras 2) is a member of the CNK family and plays a vital role in various cellular processes, including proliferation, differentiation, and survival, by acting as a scaffold protein that coordinates signaling pathways, particularly those involving Ras and Rho GTPases. Research has indicated that CNKSR2 is essential for mediating the effects of several growth factors and hormones, linking them to downstream signaling events. This protein is localized in the cytoplasm and has been found to interact with various proteins, including kinases, further emphasizing its role in signal transduction. Dysregulation of CNKSR2 has been associated with several diseases, including cancer, obesity, and neurodevelopmental disorders, highlighting its potential as a therapeutic target. In recent years, studies focusing on the recombinant expression and functional characterization of CNKSR2 have gained momentum, aiming to elucidate its complex interactions and functional mechanisms in cellular signaling. Understanding the structure and function of CNKSR2 through recombinant protein studies could pave the way for the development of novel therapeutic strategies aimed at modulating its activity in pathological conditions. This area of research is particularly significant given the increasing evidence linking CNKSR2 to critical cellular processes and disease states, making it a compelling subject for investigation in both basic and applied biomedical sciences.











