Cat: PA2000-3715

Recombinant Human CNKSR2 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    CNKSR2

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    CNKSR2;CNK2;KIAA0902;KSR2;Connector enhancer of kinase suppressor of ras 2

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q8WXI2

  • Expression Region

    650-800aa

  • AA Sequence

    AAEHLDDMNRWLNRINMLTAGYAERERIKQEQDYWSESDKEEADTPSTPKQDSPPPPYDTYPRPPSMSCASPYVEAKHSRLSSTETSQSQSSHEEFRQEVTGSSAVSPIRKTASQRRSWQDLIETPLTSSGLHYLQTLPLEDSVFSDSAAI

  • Molecular Weight

    19.1 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

CNKSR2 (Connector Enhancer of Kinase Suppressor of Ras 2) is a member of the CNK family and plays a vital role in various cellular processes, including proliferation, differentiation, and survival, by acting as a scaffold protein that coordinates signaling pathways, particularly those involving Ras and Rho GTPases. Research has indicated that CNKSR2 is essential for mediating the effects of several growth factors and hormones, linking them to downstream signaling events. This protein is localized in the cytoplasm and has been found to interact with various proteins, including kinases, further emphasizing its role in signal transduction. Dysregulation of CNKSR2 has been associated with several diseases, including cancer, obesity, and neurodevelopmental disorders, highlighting its potential as a therapeutic target. In recent years, studies focusing on the recombinant expression and functional characterization of CNKSR2 have gained momentum, aiming to elucidate its complex interactions and functional mechanisms in cellular signaling. Understanding the structure and function of CNKSR2 through recombinant protein studies could pave the way for the development of novel therapeutic strategies aimed at modulating its activity in pathological conditions. This area of research is particularly significant given the increasing evidence linking CNKSR2 to critical cellular processes and disease states, making it a compelling subject for investigation in both basic and applied biomedical sciences.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US