Analytical Data
-
Gene name
pncA
- Application
-
Alternative Names
pncA；DPC4；MADH4；Mothers against decapentaplegic homolog 4
-
Species
E.coli
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P21369
-
Expression Region
1-213aa
-
AA Sequence
MPPRALLLVDLQNDFCAGGALAVPEGDSTVDVANRLIDWCQSRGEAVIASQDWHPANHGSFASQHGVEPYTPGQLDGLPQTFWPDHCVQNSEGAQLHPLLHQKAIAAVFHKGENPLVDSYSAFFDNGRRQKTSLDDWLRDHEIDELIVMGLATDYCVKFTVLDALQLGYKVNVITDGCRGVNIQPQDSAHAFMEMSAAGATLYTLADWEETQG
-
Molecular Weight
30.9 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
pncA is a crucial gene in mycobacterial species, particularly in Mycobacterium tuberculosis, as it encodes for the enzyme pyrazinamidase, which is essential for the activation of the antitubercular prodrug pyrazinamide. Research on pncA has gained significant attention due to the persistently high rates of tuberculosis (TB) and the emergence of drug-resistant strains. Mutations in the pncA gene can hinder the conversion of pyrazinamide into its active form, leading to treatment failure and contributing to the global burden of TB. Understanding the structure and function of the pncA gene, as well as its protein product, is vital for developing novel therapeutic approaches and improving existing treatment regimens. Recent studies focus on the recombinant production of PncA protein to investigate its enzymatic properties, structure-function relationships, and interactions with pyrazinamide. This research not only aims to elucidate the mechanisms underlying drug resistance but also seeks to identify potential biomarkers for monitoring treatment response. By exploring the pncA gene and its protein, scientists hope to contribute to the design of more effective TB therapies and enhance our understanding of the molecular basis of drug resistance in Mycobacterium tuberculosis.
