Analytical Data
-
Gene name
SUGT1
- Application
-
Alternative Names
SUGT1；Protein SGT1 homolog
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9Y2Z0
-
Expression Region
115-365aa
-
AA Sequence
MGSSHHHHHHSSGLVPRGSHMHRVGQAGLQLLTSSDPPALDSQSAGITGA DANFSVWIKRCQEAQNGSESEVWTHQSKIKYDWYQTESQVVITLMIKNVQ KNDVNVEFSEKELSALVKLPSGEDYNLKLELLHPIIPEQSTFKVLSTKIE IKLKKPEAVRWEKLEGQGDVPTPKQFVADVKNLYPSSSPYTRNWDKLVGE IKEEEKNEKLEGDAALNRLFQQIYSDGSDEVKRAMNKSFMESGGTVLSTN WSDVGKRKVEINPPDDMEWKKY
-
Molecular Weight
31 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
SUGT1, or suppressor of SGTP1, is a protein that plays a pivotal role in cellular processes such as protein folding, stress response, and signal transduction. Initially discovered in the context of stress granule dynamics, SUGT1 has garnered attention for its involvement in various cellular pathways related to both normal physiological functions and disease states. Its ability to interact with chaperone proteins makes it critical in maintaining protein homeostasis, particularly under stress conditions where misfolded proteins can accumulate. Research has shown that SUGT1 is implicated in cancer biology, neurodegenerative diseases, and immune responses, highlighting its potential as a therapeutic target. Recent advances in recombinant protein technology have facilitated the production of SUGT1, enabling in-depth biochemical and biophysical studies of its structure and function. Understanding the functional mechanisms of SUGT1 through recombinant protein studies can provide insights into its biological roles and therapeutic potential, paving the way for new strategies to manipulate its activity in disease contexts. As researchers continue to explore the complexities of SUGT1 in the cellular landscape, its importance in both health and disease is becoming increasingly evident.
