Analytical Data
-
Gene name
OR5M1
- Application
-
Alternative Names
OR5M1; Olfactory receptor 5M1; OST050; Olfactory receptor OR11-208
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q8NGP8
-
Expression Region
1-315 aa
-
AA Sequence
MFSPNHTIVTEFILLGLTDDPVLEKILFGVFLAIYLITLAGNLCMILLIRTNSHLQTPMY FFLGHLSFVDICYSSNVTPNMLHNFLSEQKTISYAGCFTQCLLFIALVITEFYILASMAL DRYVAICSPLHYSSRMSKNICVCLVTIPYMYGFLSGFSQSLLTFHLSFCGSLEINHFYCA DPPLIMLACSDTRVKKMAMFVVAGFNLSSSLFIILLSYLFIFAAIFRIRSAEGRHKAFST CASHLTIVTLFYGTLFCMYVRPPSEKSVEESKITAVFYTFLSPMLNPLIYSLRNTDVILA MQQMIRGKSFHKIAV
-
Molecular Weight
35.6 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
OR5M1 is a member of the olfactory receptor (OR) gene family, which plays a critical role in the detection of odorant molecules and the sensory perception of smell. Research into OR5M1 has gained momentum due to its potential implications in various biological processes and clinical conditions. Olfactory receptors, including OR5M1, are G-protein-coupled receptors (GPCRs) that are primarily expressed in the olfactory epithelium, but emerging evidence suggests they may also have roles in non-olfactory tissues. Studies have shown that variations in OR5M1 can be associated with individual differences in olfactory sensitivity and preferences, which are important for behaviors such as food selection and social interactions. Additionally, understanding the molecular mechanisms of OR5M1 and its ligand interactions could provide insights into the development of therapies for disorders related to olfactory dysfunction, which significantly impacts the quality of life. Given the vast diversity of the OR gene family and their contribution to human sensory biology, the exploration of OR5M1 reconstitution in laboratory settings may unveil critical information about odorant processing and the intricacies of GPCR signaling pathways. Continued investigation of OR5M1 offers a promising avenue for advancing our knowledge of olfactory receptor biology and its broader implications in health and disease.
