Analytical Data
-
Gene name
OR5T3
- Application
-
Alternative Names
OR5T3; Olfactory receptor 5T3; Olfactory receptor OR11-178
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q8NGG3
-
Expression Region
1-340 aa
-
AA Sequence
MDSTFTGYNLYNLQVKTEMDKLSSGLDIYRNPLKNKTEVTMFILTGFTDDFELQVFLFLL FFAIYLFTLIGNLGLVVLVIEDSWLHNPMYYFLSVLSFLDACYSTVVTPKMLVNFLAKNK SISFIGCATQMLLFVTFGTTECFLLAAMAYDHYVAIYNPLLYSVSMSPRVYVPLITASYV AGILHATIHIVATFSLSFCGSNEIRHVFCDMPPLLAISCSDTHTNQLLLFYFVGSIEIVT ILIVLISCDFILLSILKMHSAKGRQKAFSTCGSHLTGVTIYHGTILVSYMRPSSSYASDH DIIVSIFYTIVIPKLNPIIYSLRNKEVKKAVKKMLKLVYK
-
Molecular Weight
38.3 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
The OR5T3 gene encodes a member of the olfactory receptor family, which plays a critical role in the perception of smells. Research into OR5T3 has gained attention due to its potential implications in understanding the mechanisms of olfaction and its relevance to various physiological and pathological processes. Olfactory receptors, including OR5T3, are G-protein-coupled receptors (GPCRs), making them valuable targets in drug discovery and therapeutic interventions. Investigating the structure and function of OR5T3 through recombinant protein expression allows for detailed characterization of its ligand binding properties and signaling pathways. This research is crucial since alterations in olfactory receptor function can be linked to conditions such as anosmia (loss of smell) and other neurodegenerative diseases. Furthermore, understanding OR5T3 interactions with specific odorants can enhance knowledge of the molecular basis of smell and its variations across different populations due to genetic diversity. Overall, the study of OR5T3 recombinant protein represents an important step towards unraveling the complexities of olfactory signaling, with potential applications in neuroscience, pharmacology, and genetic research.











