Cat: PA1000-3766

Recombinant Human FAM3C Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    FAM3C

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    FAM3C;ILEI;Protein FAM3C

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q92520

  • Expression Region

    25-227aa

  • AA Sequence

    QVFEIKMDASLGNLFARSALDTAARSTKPPRYKCGISKACPEKHFAFKMA SGAANVVGPKICLEDNVLMSGVKNNVGRGINVALANGKTGEVLDTKYFDM WGGDVAPFIEFLKAIQDGTIVLMGTYDDGATKLNDEARRLIADLGSTSIT NLGFRDNWVFCGGKGIKTKSPFEQHIKNNKDTNKYEGWPEVVEMEGCIPQ KQDVDHHHHHH

  • Molecular Weight

    23 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

FAM3C, a member of the FAM3 gene family, is increasingly recognized for its potential role in various biological processes and disease mechanisms. Historically, research on FAM3C has focused on its expression patterns, which indicate involvement in metabolic regulation and inflammatory responses. Emerging studies have suggested that FAM3C may serve as a cytokine or an important signaling molecule, influencing processes such as cell proliferation, migration, and differentiation. Its dysregulation has been associated with several pathological conditions, including cancer and metabolic disorders. By generating recombinant FAM3C protein, researchers aim to elucidate its functional mechanisms and interactions with cellular pathways. This recombinant protein can be utilized in various assays to investigate its effects on cell behavior, explore its receptor interactions, and assess its potential as a therapeutic target. The growing interest in understanding FAM3C’s biological roles underscores its significance in advancing our knowledge of complex cellular networks and developing novel treatment strategies for associated diseases.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US