Analytical Data
-
Gene name
Alpl
- Application
-
Alternative Names
Alpl；Alkaline phosphatase. tissue-nonspecific isozyme
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P05186
-
Expression Region
29-138aa
-
AA Sequence
WRDQAQETLKYALELQKLNTNVAKNVIMFLGDGMGVSTVTAARILKGQLH HNPGEETRLEMDKFPFVALSKTYNTNAQVPDSAGTATAYLCGVKANEGTV GVSAATERSR
-
Molecular Weight
38 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
Alpl, also known as alkaline phosphatase, is an essential enzyme in various biological processes, particularly in mineralization, which is crucial for bone formation and maintenance. The study of Alpl recombinant proteins has gained significant attention due to their potential applications in both basic research and clinical settings. Understanding the structure-function relationship of Alpl can unveil insights into metabolic bone disorders, such as osteomalacia, rickets, and other diseases resulting from dysfunctional mineralization. The recombinant expression of Alpl allows for the production of large quantities of this enzyme, enabling detailed studies on its enzymatic activity, regulation, and interaction with substrates. Furthermore, recombinant Alpl is increasingly being explored for therapeutic applications, particularly in the treatment of skeletal diseases and age-related bone loss, where enhancing bone resorption and mineralization may be beneficial. Advances in recombinant DNA technology and protein engineering have facilitated the design of modified versions of Alpl, improving stability, activity, and specificity for therapeutic purposes. Overall, the exploration of Alpl recombinant proteins is a promising area of research that bridges fundamental biology and potential clinical therapies, paving the way for innovative strategies in treating bone-related disorders.
