Cat: PA1000-4370

Recombinant Human Alpl Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    Alpl

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    Alpl;Alkaline phosphatase. tissue-nonspecific isozyme

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P05186

  • Expression Region

    29-138aa

  • AA Sequence

    WRDQAQETLKYALELQKLNTNVAKNVIMFLGDGMGVSTVTAARILKGQLH HNPGEETRLEMDKFPFVALSKTYNTNAQVPDSAGTATAYLCGVKANEGTV GVSAATERSR

  • Molecular Weight

    38 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

Alpl, also known as alkaline phosphatase, is an essential enzyme in various biological processes, particularly in mineralization, which is crucial for bone formation and maintenance. The study of Alpl recombinant proteins has gained significant attention due to their potential applications in both basic research and clinical settings. Understanding the structure-function relationship of Alpl can unveil insights into metabolic bone disorders, such as osteomalacia, rickets, and other diseases resulting from dysfunctional mineralization. The recombinant expression of Alpl allows for the production of large quantities of this enzyme, enabling detailed studies on its enzymatic activity, regulation, and interaction with substrates. Furthermore, recombinant Alpl is increasingly being explored for therapeutic applications, particularly in the treatment of skeletal diseases and age-related bone loss, where enhancing bone resorption and mineralization may be beneficial. Advances in recombinant DNA technology and protein engineering have facilitated the design of modified versions of Alpl, improving stability, activity, and specificity for therapeutic purposes. Overall, the exploration of Alpl recombinant proteins is a promising area of research that bridges fundamental biology and potential clinical therapies, paving the way for innovative strategies in treating bone-related disorders.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US