Analytical Data
-
Gene name
PARK7
- Application
-
Alternative Names
PARK7；Parkinson disease Protein 7
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q99497
-
Expression Region
19-189aa
-
AA Sequence
TVIPVDVMRRAGIKVTVAGLAGKDPVQCSRDVVICPDASLEDAKKEGPYD VVVLPGGNLGAQNLSESAAVKEILKEQENRKGLIAAICAGPTALLAHEIG FGSKVTTHPLAKDKMMNGGHYTYSENRVEKDGLILTSRGPGTSFEFALAI VEALNGKEVAAQVKAPLVLKD
-
Molecular Weight
22 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
PARK7, also known as DJ-1, is a protein that has garnered significant interest in the field of neurodegenerative disease research, particularly in relation to Parkinson's disease. Mutations in the PARK7 gene are linked to familial forms of Parkinson's, highlighting its role as a protective factor against oxidative stress and mitochondrial dysfunction, both of which are implicated in neuronal cell death. Furthermore, PARK7 is involved in various cellular processes, including the regulation of protein quality control and the response to oxidative stress, which are crucial for maintaining neuronal health. The study of PARK7 and its recombinant forms has the potential to elucidate the underlying mechanisms of neurodegeneration and to develop therapeutic strategies aimed at enhancing its protective functions. By understanding the structural and functional properties of PARK7, researchers aim to explore its interactions with other proteins and its role in cellular pathways that contribute to neuroprotection. As such, recombinant PARK7 serves as a valuable tool for investigating its biochemical properties and the potential impact of PARK7-related therapies in mitigating the progression of Parkinson's disease and other neurodegenerative conditions.
