Analytical Data
-
Gene name
FXYD2
- Application
-
Alternative Names
FXYD2；ATP1C；ATP1G1；Sodium/potassium-transporting ATPase subunit gamma
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P54710
-
Expression Region
1-64aa
-
AA Sequence
MDRWYLGGSPKGDVDPFYYDYETVRNGGLIFAGLAFIVGLLILLSRRFRCGGNKKRRQINEDEP
-
Molecular Weight
34.4 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
FXYD2 is a member of the FXYD protein family, which plays a critical role in modulating ion transport in epithelial cells. Specifically, FXYD2 is known to interact with the Na+/K+ ATPase, affecting its activity and function, which is essential for maintaining cellular ion homeostasis. The expression of FXYD2 is found to be regulated in various physiological and pathological conditions, including cardiac and renal functions. Research has indicated that alterations in FXYD2 expression correlate with several diseases, such as hypertension and heart failure, thus highlighting its potential as a biomarker for these conditions. Recombinant FXYD2 protein is therefore of considerable interest for studying its structure-function relationships and identifying the molecular mechanisms underlying its role in ion transport and cellular signaling pathways. The recombinant form allows researchers to investigate its biophysical properties, interactions with other membrane proteins, and its impact on ion pump activity in a controlled environment. Understanding FXYD2 through recombinant protein studies can contribute to elucidating its biological significance and may offer insights into therapeutic targets for related disorders. As research progresses, the development and application of FXYD2 recombinant protein could pave the way for novel interventions in diseases associated with disrupted ion transport.
