Cat: PA2000-2242

Recombinant Human TDO2 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    TDO2

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    TDO2;TDO;Tryptophan 2.3-dioxygenase

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P48775

  • Expression Region

    1-406aa

  • AA Sequence

    MSGCPFLGNNFGYTFKKLPVEGSEEDKSQTGVNRASKGGLIYGNYLHLEK VLNAQELQSETKGNKIHDEHLFIITHQAYELWFKQILWELDSVREIFQNG HVRDERNMLKVVSRMHRVSVILKLLVQQFSILETMTALDFNDFREYLSPA SGFQSLQFRLLENKIGVLQNMRVPYNRRHYRDNFKGEENELLLKSEQEKT LLELVEAWLERTPGLEPHGFNFWGKLEKNITRGLEEEFIRIQAKEESEEK EEQVAEFQKQKEVLLSLFDEKRHEHLLSKGERRLSYRALQGALMIYFYRE EPRFQVPFQLLTSLMDIDSLMTKWRYNHVCMVHRMLGSKAGTGGSSGYHY LRSTVSDRYKVFVDLFNLSTYLIPRHWIPKMNPTIHKFLYTAEYCDSSYF SSDESD

  • Molecular Weight

    48 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

TDO2, or tryptophan 2,3-dioxygenase, is an enzyme that plays a crucial role in the catabolism of tryptophan, an essential amino acid. It is primarily found in the liver and is responsible for the oxidative cleavage of tryptophan, which leads to the production of kynurenine and other metabolites involved in various biological processes. Research on TDO2 has gained significant attention due to its implications in several physiological and pathological conditions, including neurodegenerative diseases, cancer, and immunological disorders. Elevated levels of TDO2 have been associated with immune suppression and tumor progression, as the kynurenine pathway can modulate immune responses and promote a tolerogenic environment favorable to tumor growth. Moreover, alterations in tryptophan metabolism are linked to mood disorders and cognitive function, suggesting a potential role for TDO2 in psychiatric conditions. Thus, the study of TDO2 recombinant proteins aims to elucidate the enzyme's structure, function, and biological significance, paving the way for potential therapeutic interventions targeting the kynurenine pathway. Understanding TDO2's mechanisms may lead to novel strategies for treating diseases where tryptophan metabolism is disrupted, offering prospects for improved patient outcomes and novel pharmacological approaches. The ongoing research may also help identify biomarkers for disease prognosis and response to treatment, contributing to personalized medicine in the management of complex health issues.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US