Analytical Data
-
Gene name
RO60
- Application
-
Alternative Names
RO60;SSA2;TROVE2;RNA-binding Protein RO60
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P10155
-
Expression Region
3-535aa
-
AA Sequence
ESVNQMQPLNEKQIANSQDGYVWQVTDMNRLHRFLCFGSEGGTYYIKEQKLGLENAEALIRLIEDGRGCEVIQEIKSFSQEGRTTKQEPMLFALAICSQCSDISTKQAAFKAVSEVCRIPTHLFTFIQFKKDLKESMKCGMWGRALRKAIADWYNEKGGMALALAVTKYKQRNGWSHKDLLRLSHLKPSSEGLAIVTKYITKGWKEVHELYKEKALSVETEKLLKYLEAVEKVKRTRDELEVIHLIEEHRLVREHLLTNHLKSKEVWKALLQEMPLTALLRNLGKMTANSVLEPGNSEVSLVCEKLCNEKLLKKARIHPFHILIALETYKTGHGLRGKLKWRPDEEILKALDAAFYKTFKTVEPTGKRFLLAVDVSASMNQRVLGSILNASTVAAAMCMVVTRTEKDSYVVAFSDEMVPCPVTTDMTLQQVLMAMSQIPAGGTDCSLPMIWAQKTNTPADVFIVFTDNETFAGGVHPAIALREYRKKMDIPAKLIVCGMTSNGFTIADPDDRGMLDMCGFDTGALDVIRNFTL
-
Molecular Weight
64.1 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
The study of the RO60 protein, a key component of the Ro ribonucleoprotein complex, has garnered significant attention due to its multifaceted roles in cellular processes and implications for autoimmune diseases. RO60, encoded by the SSA/Ro gene, is widely recognized for its involvement in the immune response, contributing to the production of autoantibodies in conditions such as Sjögren's syndrome and systemic lupus erythematosus. Its function as an RNA-binding protein allows it to interact with various RNA molecules, influencing cellular stress responses and gene regulation. Recent advances in structural biology and molecular techniques have enabled researchers to delineate the conformational nuances and binding mechanisms of RO60, shedding light on its role in immune regulation and potential as a therapeutic target. The protein's dual function in facilitating both immune tolerance and autoimmunity highlights its significance in understanding the delicate balance of the immune system. In addition, investigations into the post-translational modifications of RO60 may unveil further regulatory layers, offering insights into the pathogenesis of related autoimmune disorders. The ongoing research into RO60 not only enriches our understanding of RNA-protein interactions but also holds promise for developing novel diagnostic and therapeutic strategies for autoimmune diseases.











