Analytical Data
-
Gene name
C1QTNF7
- Application
-
Alternative Names
C1q and tumor necrosis factor related Protein 7; C1QT7_HUMAN; C1QTNF7; Complement C1q tumor necrosis factor related Protein 7; Complement C1q tumor necrosis factor-related Protein 7; CTRP 7; ZACRP7
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9BXJ2
-
Expression Region
1-289aa
-
AA Sequence
MFVLLYVTSFAICASGQPRGNQLKGENYSPRYICSIPGLPGPPGPPGANGSPGPHGRIGLPGRDGRDGRKGEKGEKGTAGLRGKTGPLGLAGEKGDQGETGKKGPIGPEGEKGEVGPIGPPGPKGDRGEQGDPGLPGVCRCGSIVLKSAFSVGITTSYPEERLPIIFNKVLFNEGEHYNPATGKFICAFPGIYYFSYDITLANKHLAIGLVHNGQYRIKTFDANTGNHDVASGSTVIYLQPEDEVWLEIFFTDQNGLFSDPGWADSLFSGFLLYVDTDYLDSISEDDEL
-
Molecular Weight
57.1 KDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
C1QTNF7, also known as C1q tumor necrosis factor-related protein 7, is a member of the adiponectin family of proteins, which are implicated in various metabolic and inflammatory processes. Recent research has highlighted its potential roles in modulating immune responses and its association with obesity-related disorders. Understanding the biological function of C1QTNF7 is crucial, as alterations in its expression have been linked to diseases such as diabetes, cardiovascular conditions, and certain types of cancer. Studies have shown that C1QTNF7 may serve as a biomarker for these diseases and could be a target for therapeutic interventions. However, the precise molecular mechanisms through which C1QTNF7 exerts its effects remain largely unexplored. Investigating the recombinant protein form of C1QTNF7 can provide insights into its structure-function relationships and biological activities, paving the way for novel medical applications. By elucidating the role of C1QTNF7 in cellular processes, researchers aim to develop strategies for manipulating its pathways to combat metabolic and inflammatory diseases, thereby improving health outcomes.
