Cat: PA2000-6164

Recombinant Human C20orf149 Protein,GST

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    C20orf149

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    C20orf149; dJ697K14.9; Exdpf; Exocrine differentiation and proliferation factor; Pancreatic progenitor cell differentiation and proliferation factor; Pancreatic progenitor cell differentiation and proliferation factor homolog; PPDPF; PPDPF_HUMAN

  • Species

    Human

  • Source

    E. coli

  • Tag

    GST-tag at N-terminal

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q9H3Y8

  • Expression Region

    1-114aa

  • AA Sequence

    MAAIPSSGSLVATHDYYRRRLGSTSSNSSCSSTECPGEAIPHPPGLPKADPGHWWASFFFGKSTLPFMATVLESAEHSEPPQASSSMTACGLARDAPRKQPGGQSSTASAGPPS

  • Molecular Weight

    38.2 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

C20orf149, also known as a candidate gene located on chromosome 20, has garnered interest in recent years due to its potential roles in various biological processes and diseases. Research indicates that C20orf149 may be involved in cell proliferation, differentiation, and apoptosis, which are critical for normal development and homeostasis. Its expression patterns are particularly intriguing; studies have shown that it is upregulated in certain cancers and may contribute to tumorigenesis, making it a potential biomarker for cancer diagnosis and prognosis. Furthermore, the functional characterization of C20orf149 through recombinant protein studies could elucidate its molecular mechanisms and interactions within cellular pathways. Expression of C20orf149 as a recombinant protein allows researchers to examine its properties, interactions with other proteins, and its functional significance in vitro. Understanding the biochemical characteristics and biological functions of C20orf149 could provide insights into its role in health and disease, potentially leading to novel therapeutic strategies. The ongoing exploration of C20orf149 not only enhances our comprehension of its biological importance but also invites further investigation into its implications in cancer biology and other related fields.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US