Analytical Data
-
Gene name
C2orf34
- Application
-
Alternative Names
CAMKMT; C2orf34; CLNMTCalmodulin-lysine N-methyltransferase; CLNMT; CaM KMT; EC 2.1.1.60
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q7Z624
-
Expression Region
1-323aa
-
AA Sequence
MESRVADAGTGETARAAGGSPAVGCTTRGPVVSAPLGAARWKLLRQVLKQKHLDDCLRHVSVRRFESFNLFSVTEGKERETEEEVGAWVQYTSIFCPEYSISLRHNSGSLNVEDVLTSFDNTGNVCIWPSEEVLAYYCLKHNNIFRALAVCELGGGMTCLAGLMVAISADVKEVLLTDGNEKAIRNVQDIITRNQKAGVFKTQKISSCFLRWDNETDVSQLEGHFDIVMCADCLFLDQYRASLVDAIKRLLQPRGKAMVFAPRRGNTLNQFCNLAEKAGFCIQRHENYDEHISNFHSKLKKENPDIYEENLHYPLLLILTKHG
-
Molecular Weight
62.6 KDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
C2orf34, also known as Chromosome 2 Open Reading Frame 34, is a gene located on human chromosome 2 that has garnered attention for its potential roles in cellular processes, including proliferation and differentiation. Recent studies have suggested that C2orf34 may be involved in various biological pathways, including those related to cancer and genetic disorders. Despite this, the specific functions and mechanisms of C2orf34 at the molecular level remain largely unexplored. The production of recombinant C2orf34 protein has become crucial for elucidating its structure and function. By generating this protein in a controlled environment, researchers can perform biochemical assays, structural analyses, and interaction studies to better understand its role in cellular signaling and potential implications in disease. Additionally, recombinant C2orf34 can serve as a valuable tool for developing targeted therapeutic strategies and diagnostic tools, addressing the gaps in knowledge surrounding this enigmatic protein. As the field of proteomics advances, the study of C2orf34 underscores the importance of investigating lesser-known proteins that may hold significant clinical relevance.
