Analytical Data
-
Gene name
C2orf83
- Application
-
Alternative Names
C2orf83; Folate transporter-like Protein C2orf83
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q53S99
-
Expression Region
1-140aa
-
AA Sequence
MEDYALTFGINPFIALMIQPIVTMTVVDNQGLGLPVDIQHKAKPSPKASQMLPPDLGPPSFQNLLSPSEKLEPWDPGMRKLTVQTCGLTFIHPAGHGLCHPTAQASAETLSSTALNRPSVREGACNEKSTENKKPQDSVL
-
Molecular Weight
41.8 KDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
C2orf83, also known as Chromosome 2 Open Reading Frame 83, has garnered interest in the field of molecular biology due to its potential roles in various physiological and pathological processes. Initially identified through genomic studies, C2orf83 is located on chromosome 2 and has been associated with gene regulation and cellular signaling pathways. Research has suggested that C2orf83 may be involved in the cellular response to stress, inflammation, and apoptosis, making it a candidate for investigating its functions in diseases such as cancer and neurodegenerative disorders. The study of its recombinant protein allows researchers to explore its structural features and biochemical properties in detail, providing insights into its mechanism of action within cells. Furthermore, the ability to produce C2orf83 as a recombinant protein enables the development of specific antibodies and potential therapeutic applications, highlighting its importance in both basic research and clinical contexts. The mounting evidence regarding its biological significance underlines the necessity for comprehensive studies focusing on its functional roles and interactions within the cellular environment, paving the way for understanding its contributions to human health and disease.
