Analytical Data
-
Gene name
C5orf36
- Application
-
Alternative Names
KIAA0825; C5orf36; Uncharacterized Protein KIAA0825
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q8IV33
-
Expression Region
1-324aa
-
AA Sequence
MDWDDEYSHNSFDLHCLLNSFPGDLEFEQIFSDIDEKIEQNAASIKHCIKEIQSEINKQCPGVQLQTTTDCFEWLTNYNYSTSESSFISHGDLIKFFKTLQDLLKNEQNQEEMTLDLLWDLSCHSSVSFPSTLSGTSFHFLSRTSLHSVEDNSSMDVKSMWDDIRLHLRRFLVSKLQSHNEINNSQQKILLKKQCLQQLLFLYPESEVIIKYQNIQNKLLANLLWNCFPSYNRDSNLDVIAHGYQSTMLKLYSVIKEDFNTLCEILAPSSMVKFIKETYLDTVTEEMAKFLENFCELQFRENAVRVVKTSKSSSKHRGAVHALG
-
Molecular Weight
64 KDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
C5orf36, also known as chromosome 5 open reading frame 36, is a protein that has garnered attention in recent years due to its potential roles in various biological processes and diseases. The gene encoding C5orf36 is located on chromosome 5 and has been implicated in several cellular functions, although its exact physiological role remains largely unclear. Research indicates that C5orf36 may be involved in cellular signaling pathways, immune responses, and possibly in the regulation of gene expression. Its association with certain pathologies, including some neurodegenerative diseases and cancers, suggests that understanding its structure and function could yield insights into disease mechanisms and potential therapeutic targets. Additionally, the recombinant expression of C5orf36 protein is essential for studying its biochemical properties and interactions with other cellular components. By exploring its structural and functional characteristics through recombinant technology, researchers aim to elucidate the role of C5orf36 in health and disease, providing a foundation for future studies that could lead to novel interventions or biomarkers. This growing body of research underscores the significance of C5orf36 in molecular biology and medicine, highlighting the need for further investigation to unlock its full potential in understanding complex biological systems.
