Analytical Data
-
Gene name
C6orf203
- Application
-
Alternative Names
MTRES1; C6orf203; HSPC230; Mitochondrial transcription rescue factor 1
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9P0P8
-
Expression Region
1-240aa
-
AA Sequence
MAMASVKLLAGVLRKPDAWIGLWGVLRGTPSSYKLCTSWNRYLYFSSTKLRAPNYKTLFYNIFSLRLPGLLLSPECIFPFSVRLKSNIRSTKSTKKSLQKVDEEDSDEESHHDEMSEQEEELEDDPTVVKNYKDLEKAVQSFRYDVVLKTGLDIGRNKVEDAFYKGELRLNEEKLWKKSRTVKVGDTLDLLIGEDKEAGTETVMRILLKKVFEEKTESEKYRVVLRRWKSLKLPKKRMSK
-
Molecular Weight
54.3 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
C6orf203, also known as chromosome 6 open reading frame 203, has garnered attention in recent years due to its potential role in cellular processes and its implications in various diseases. Located on chromosome 6, this gene encodes a protein that is believed to be involved in important biological functions, including cell signaling, growth regulation, and apoptosis. Studies have indicated that alterations in C6orf203 expression may be linked to cancer progression and other pathological conditions, thus highlighting its potential as a biomarker or therapeutic target. The recombinant expression of C6orf203 protein enables researchers to investigate its functional properties, interactions, and mechanisms further in a controlled environment. By producing this protein in various expression systems, scientists aim to characterize its structure and activity, paving the way for understanding its biological significance. Additionally, exploring C6orf203's role in cellular pathways may provide insights into its involvement in diseases, facilitating the development of novel diagnostic or therapeutic strategies. Overall, the research on C6orf203 recombinant protein is crucial for unraveling its biological roles and establishing its relevance in human health and disease.
