Cat: IPD-X10633

Recombinant Human IL-1 beta Protein , N-10*His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    IL-1 beta

  • 简介

    IL-1 beta is a potent proinflammatory cytokine expressed by monocytes, macrophages, and dendritic cells. IL-1 beta plays a key role in inflammation and immunologic reactions[1][2]. IL-1 beta Protein, Human (E6K, His) is produced in E. coli with a N-Terminal His-tag. It consists of 269 amino acids (M1-S269).

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Biological Activity

    Measured by its binding ability in a functional ELISA. Immobilized human IL1B at 10 μg/mL (100 μl/well) can bind human IL1R1 and the EC50 is 0.1-1.5 μg/mL. Measured by its binding ability in a functional ELISA. Immobilized human IL1B at 10 μg/mL (100 μL/well) can bind human IL1R1 and the EC50 is 1.242 μg/mL.

  • Alternative Names

    Interleukin-1 beta; IL-1β; IL1F2; IL-1 beta; IL1B

  • Species

    Human

  • Source

    E. coli

  • Tag

    N-10*His

  • Purity

    Greater than 95% as determined by reducing SDS-PAGE. as determined by SDS-PAGE.

  • Uniprot

    P01584

  • Expression Region

    M1-S269, E6K

  • AA Sequence

    MAEVPKLASEMMAYYSGNEDDLFFEADGPKQMKCSFQDLDLCPLDGGIQLRISDHHYSKGFRQAASVVVAMDKLRKMLVPCPQTFQENDLSTFFPFIFEEEPIFFDTWDNEAYVHDAPVRSLNCTLRDSQQKSLVMSGPYELKALHLQGQDMEQQVVFSMSFVQGEESNDKIPVALGLKEKNLYLSCVLKDDKPTLQLESVDPKNYPKKKMEKRFVFNKIEINNKLEFESAQFPNWYISTSQAENMPVFLGGTKGGQDITDFTMQFVSS

  • Protein Length

    Full Length

  • Molecular Weight

    32-34 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

Interleukin-1 beta (IL-1β) is a pro-inflammatory cytokine that plays a crucial role in the immune response and inflammatory processes. Its dysregulation is implicated in various pathological conditions, including autoimmune diseases, chronic inflammatory disorders, and even certain cancers. IL-1β is primarily produced by activated macrophages and is known to influence the activity of various immune cells, promoting the expression of other pro-inflammatory cytokines and mediators. The research surrounding recombinant IL-1β protein focuses on understanding its structure, function, and the signaling pathways it activates. Recombinant forms of IL-1β are utilized in experimental therapies and investigational studies to explore their potential in treating diseases characterized by excessive inflammation. Furthermore, advancements in recombinant DNA technology have allowed for the production of high-purity IL-1β, facilitating rigorous studies of its biological activities and therapeutic applications. Researchers are particularly interested in its role as a therapeutic target to mitigate chronic inflammatory conditions, assessing its use in both in vitro and in vivo models. Overall, the study of IL-1β recombinant protein is vital for elucidating its mechanisms in inflammation and exploring novel therapeutic interventions to modulate immune responses in various diseases.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US