Analytical Data
-
Gene name
MAP3K7CL
- Application
-
Alternative Names
MAP3K7CL；C21orf7；TAK1L；MAP3K7 C-terminal-like Protein
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P57077
-
Expression Region
1-142aa
-
AA Sequence
MISTARVPADKPVRIAFSLNDASDDTPPEDSIPLVFPELDQQLQPLPPCHDSEESMEVFKQHCQIAEEYHEVKKEITLLEQRKKELIAKLDQAEKEKVDAAELVREFEALTEENRTLRLAQSQCVEQLEKLRIQYQKRQGSS
-
Molecular Weight
32.4 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
MAP3K7CL, also known as MAP kinase activator 1, is a member of the mitogen-activated protein kinase (MAPK) signaling pathway, which plays a crucial role in various cellular processes, including proliferation, differentiation, and apoptosis. The significance of MAP3K7CL in cancer biology and other diseases has garnered attention due to its involvement in transducing signals from extracellular stimuli to intracellular responses. This protein functions as a kinase that activates downstream MAPK cascades, influencing cell fate decisions. Recent studies have suggested that dysregulation of MAP3K7CL may contribute to tumorigenesis and resistance to therapies, highlighting the necessity of understanding its molecular mechanisms. Additionally, research has pointed towards MAP3K7CL's potential as a therapeutic target, with recombinant protein studies paving the way for the development of new treatment strategies. By generating and investigating MAP3K7CL recombinant proteins, researchers aim to elucidate its interaction with other signaling molecules and pathways, enhance our understanding of its role in health and disease, and ultimately contribute to the discovery of novel interventions for related pathologies. This area of research continues to evolve, with ongoing studies focusing on the structural and functional characterization of MAP3K7CL, thus opening up new avenues for pharmacological exploitation.
