Cat: PAX2000-10910

Recombinant Human RIN2 Protein,GST

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    RIN2

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    RIN2; RASSF4; Ras and Rab interactor 2; Ras association domain family 4; Ras inhibitor JC265; Ras interaction/interference protein 2

  • Species

    Human

  • Source

    E. coli

  • Tag

    GST-tag at N-terminal

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q8WYP3

  • Expression Region

    786-894 aa

  • AA Sequence

    DFQNYLRVAFQEVNSGCTGKTLLVRPYITTEDVCQICAEKFKVGDPEEYSLFLFVDETWQQLAEDTYPQKIKAELHSRPQPHIFHFVYKRIKNDPYGIIFQNGEEDLTT

  • Molecular Weight

    37.73 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

RIN2, a member of the Rab GTPase-activating protein family, plays a crucial role in the regulation of intracellular vesicle trafficking and exocytosis. Its importance is underscored by its involvement in diverse cellular processes, including the modulation of insulin secretion in pancreatic beta cells and neurotransmitter release in neurons. Research on RIN2 has gained traction due to its potential implications in metabolic disorders and neurodegenerative diseases. The recombinant protein form of RIN2 is utilized to elucidate its specific functions and interactions at a molecular level. By generating RIN2 recombinant protein, researchers aim to investigate its biochemical properties, structure-function relationship, and the signaling pathways it influences. Understanding RIN2's role in vesicle dynamics could provide insights into the underlying mechanisms of diseases such as diabetes and Alzheimer's, paving the way for the development of novel therapeutic strategies. Moreover, the study of RIN2 interactions with other proteins involved in the trafficking process could identify key regulatory networks critical for cellular homeostasis. Thus, the research on RIN2 recombinant protein not only contributes to the fundamental understanding of cellular mechanisms but also has significant implications for human health.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US