Analytical Data
-
Gene name
BAM3
- Application
-
Alternative Names
BAM3；BMY8；CTBMY；Beta-amylase 3. chloroplastic
-
Species
Arabidopsis thaliana
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
O23553
-
Expression Region
50-548aa
-
AA Sequence
EMKFTHEKTFTPEGETLEKWEKLHVLSYPHSKNDASVPVFVMLPLDTVTMSGHLNKPRAMNASLMALKGAGVEGVMVDAWWGLVEKDGPMNYNWEGYAELIQMVQKHGLKLQVVMSFHQCGGNVGDSCSIPLPPWVLEEISKNPDLVYTDKSGRRNPEYISLGCDSVPVLRGRTPIQVYSDFMRSFRERFEGYIGGVIAEIQVGMGPCGELRYPSYPESNGTWRFPGIGEFQCYDKYMKSSLQAYAESIGKTNWGTSGPHDAGEYKNLPEDTEFFRRDGTWNSEYGKFFMEWYSGKLLEHGDQLLSSAKGIFQGSGAKLSGKVAGIHWHYNTRSHAAELTAGYYNTRNHDGYLPIAKMFNKHGVVLNFTCMEMKDGEQPEHANCSPEGLVKQVQNATRQAGTELAGENALERYDSSAFGQVVATNRSDSGNGLTAFTYLRMNKRLFEGQNWQQLVEFVKNMKEGGHGRRLSKEDTTGSDLYVGFVKGKIAENVEEAALV
-
Molecular Weight
59.4 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
BAM3, a member of the Type I membrane protein family, has drawn significant attention in recent years due to its potential role in various biological processes and disease mechanisms. This protein is primarily known for its involvement in the assembly and stability of membrane proteins within the endoplasmic reticulum and has been implicated in the proper folding of other proteins. The study of BAM3 is particularly relevant in the context of protein misfolding and aggregation, which are critical factors in neurodegenerative diseases such as Alzheimer's and Parkinson's. Research efforts have focused on understanding the structure-function relationship of BAM3 and its interaction with other cellular components, using techniques such as X-ray crystallography and cryo-electron microscopy. Moreover, BAM3's potential as a therapeutic target has sparked interest in drug design, aiming to modulate its activity to enhance protein folding mechanisms. As investigations into BAM3 progress, insights gained from these studies may lead to novel strategies in treating diseases associated with protein misfolding. Overall, BAM3 presents a promising avenue for research in cell biology and medicine, underscoring the intricate balance between protein homeostasis and cellular health.
