Analytical Data
-
Gene name
CENPW
- Application
-
Alternative Names
C6ORF173; cancer upregulated gene 2; Cancer-up-regulated gene 2 Protein; CENP-W; cenpw; CENPW_HUMAN; Centromere Protein W; chromosome 6 open reading frame 173; CUG2; hypothetical Protein LOC387103
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q5EE01
-
Expression Region
1-88aa
-
AA Sequence
MALSTIVSQRKQIKRKAPRGFLKRVFKRKKPQLRLEKSGDLLVHLNCLLFVHRLAEESRTNACASKCRVINKEHVLAAAKVILKKSRG
-
Molecular Weight
36.08 KDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
CENPW is a protein that plays a crucial role in the assembly and function of kinetochores, which are essential for accurate chromosome segregation during cell division. Research on CENPW has gained significant attention due to its involvement in the mitotic process and potential implications in cancer biology, where misregulation of cell division can lead to aneuploidy and tumorigenesis. Mutations or aberrant expression levels of CENPW have been linked to various malignancies, making it a target of interest for therapeutic strategies. Furthermore, understanding the structure and functional mechanisms of CENPW could reveal insights into the broader landscape of kinetochore dynamics and its interactions with other cellular components during the cell cycle. As researchers aim to elucidate the role of CENPW in maintaining genomic stability, investigations into its biochemical properties, such as protein-protein interactions and post-translational modifications, are also becoming increasingly relevant. By employing techniques like recombinant protein expression and purification, scientists are able to study CENPW in detail, paving the way for potential applications in cancer treatment and the development of novel therapeutic agents that could mitigate the repercussions of compromised cell division. Overall, the study of CENPW and its associated pathways represents a promising avenue in understanding cancer biology and enhancing our knowledge of cell cycle regulation.
