Analytical Data
-
Gene name
CMPK2
- Application
-
Alternative Names
Cmpk2; CMPK2_HUMAN; Cytidine monophosphate (UMP CMP) kinase 2; mitochondrial; mitochondrial; Mitochondrial UMP CMP kinase; OTTHUMP00000200305; Thymidine monophosphate kinase 2; TMPK2; TYKi; UMP CMP kinase 2
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q5EBM0
-
Expression Region
151-250aa
-
AA Sequence
GACQEAPRPHLGEFEADPRGQLWQRLWEVQDGRRLQVGCAQVVPVPEPPLHPVVPDLPSSVVFPDREAARAVLEECTSFIPEARAVLDLVDQCPKQIQKG
-
Molecular Weight
36.74 KDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
CMPK2 (cytidine monophosphate kinase 2) is a crucial enzyme involved in nucleotide metabolism, particularly in the phosphorylation of cytidine monophosphate (CMP) to cytidine diphosphate (CDP). This enzyme plays a significant role in the regulation of cellular energy and the synthesis of nucleotides, which are essential for DNA and RNA synthesis. Research on CMPK2 has garnered attention due to its involvement in various biological processes and potential implications in cancer biology and metabolic disorders. Enhanced expression of CMPK2 has been linked to increased cancer cell proliferation, making it a potential target for therapeutic intervention. Additionally, CMPK2 may have implications in the metabolic adaptation of cancer cells, allowing them to survive in nutrient-poor environments. Understanding the structure and function of CMPK2 through the study of its recombinant protein is vital for elucidating its biochemical properties and regulatory mechanisms. This research can contribute to the development of novel strategies for targeting CMPK2 in cancer treatment and metabolism-related diseases, thus highlighting the enzyme's significance in both basic and applied biomedical research. Exploring the properties of recombinant CMPK2 may also facilitate the discovery of inhibitors that could serve as potential therapeutic agents. Overall, the investigation of CMPK2 and its recombinant protein offers promising opportunities for advancing our knowledge of nucleotide metabolism and its role in health and disease.
