Analytical Data
-
Gene name
COX7C
- Application
-
Alternative Names
COX7CCytochrome c oxidase subunit 7C; mitochondrial; Cytochrome c oxidase polypeptide VIIc
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P15954
-
Expression Region
1-63aa
-
AA Sequence
MLGQSIRRFTTSVVRRSHYEEGPGKNLPFSVENKWSLLAKMCLYFGSAFATPFLVVRHQLLKT
-
Molecular Weight
32.56 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
COX7C, a vital subunit of cytochrome c oxidase (CCO), plays a crucial role in cellular energy metabolism by facilitating electron transfer within the mitochondrial respiratory chain. This enzyme complex is pivotal for ATP production, and its dysfunction is linked to various metabolic disorders and neurodegenerative diseases. Recent studies have highlighted the importance of COX7C in influencing mitochondrial function and oxidative stress responses. This has spurred interest in the recombinant expression of COX7C, enabling researchers to investigate its structural and functional properties in detail. The availability of recombinant COX7C offers new avenues for understanding its role in respiratory complex assembly, stability, and activity. Furthermore, exploring the interactions of COX7C with other components of the respiratory chain may provide insights into the mechanisms underlying mitochondrial pathologies. Additionally, studying this protein in different model systems can aid in the development of potential therapeutic strategies targeting mitochondrial dysfunctions. Overall, COX7C recombinant protein research holds promise for elucidating the complexities of mitochondrial biology and its implications in health and disease.
