Analytical Data
-
Gene name
CSPG3
- Application
-
Alternative Names
Chondroitin sulfate proteoglycan 3; Cspg3; Ncan; NCAN_HUMAN; NEUR; Neurocan core protein; Neurocan proteoglycan
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
O14594
-
Expression Region
81-179aa
-
AA Sequence
VRTASGQRQDLPILVAKDNVVRVAKSWQGRVSLPSYPRRRANATLLLGPLRASDSGLYRCQVVRGIEDEQDLVPLEVTGVVFHYRSARDRYALTFAEAQ
-
Molecular Weight
36.63 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
CSPG3, or chondroitin sulfate proteoglycan 3, is a member of the lectican family of extracellular matrix proteins, primarily expressed in the central nervous system and various other tissues. It plays a significant role in cell adhesion, proliferation, and migration, contributing to normal developmental processes, extracellular matrix organization, and neuronal function. Research has indicated that CSPG3 may be involved in various pathological conditions, including neurodevelopmental disorders, cancer progression, and tissue repair mechanisms. Due to its unique structure, characterized by a protein core attached to glycosaminoglycan chains, CSPG3 is of particular interest for therapeutic applications and biomolecular studies. The recombinant production of CSPG3 allows for the exploration of its biological functions and interactions in a controlled environment, facilitating studies on its potential roles in disease mechanisms and regenerative medicine. Understanding the detailed properties of CSPG3 through recombinant protein studies may yield insights into its functions and open avenues for novel therapeutic strategies, leveraging its properties for tissue engineering, drug delivery, and innovative treatments in neurobiology and oncology. Additionally, the ability to produce CSPG3 in a recombinant form paves the way for high-throughput screening of binding partners and the development of CSPG3-targeted therapies, underscoring the importance of this research in both fundamental biology and clinical applications.
