Analytical Data
-
Gene name
RC0497
- Application
-
Alternative Names
RC0497；
-
Species
E.coli
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q92IC3
-
Expression Region
1-267aa
-
AA Sequence
MSKSKAIENNGISNTNSPNGKYMAPRPEGVKPTCVVITYSVSKDIKAVREVLDERGASVHYIIDKDGTQKEYHNDLTDQAFYAGKSSWKGEVGVNKFGIGVMLINDAKSDFPAEQIGKLKEFLKDVTERYPNLDLKHDLVGLGEVTVNREGNAHIAPGSKFPWKELAEAGFGRYFETTQEQKSKLLLSLDSTGEKVNTLQENLKEYGYGVESTSTFDQFTQQAVRVFNDRYGTGLPNEEPPVSWTEAGQDVLSQLLGQTVLEQTENA
-
Molecular Weight
45.6 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
RC0497 is a recombinant protein that has garnered significant attention in the field of biomedical research due to its potential therapeutic applications. This protein is derived from a specific strain of bacteria and is engineered to exhibit properties that can modulate immune responses. The growing prevalence of various autoimmune diseases and infections has prompted researchers to explore innovative treatments that can enhance immune system functionality without triggering adverse effects. Initial studies on RC0497 have demonstrated its ability to stimulate immune cell activation, thereby improving the body’s defensive mechanisms against pathogens. Additionally, the protein's unique structural features allow for better stability and activity compared to naturally occurring counterparts, making it a promising candidate for further development. As the understanding of immune modulation expands, RC0497’s role could extend to areas such as vaccine development and personalized medicine. Ongoing research aims to elucidate the underlying mechanisms of action, optimal dosing regimens, and potential side effects associated with its use. By exploring the versatility of RC0497, scientists hope to pave the way for novel therapeutic strategies that can revolutionize treatment protocols for a range of immunological disorders.
