Analytical Data
-
Gene name
ARPC5L
- Application
-
Alternative Names
ARPC5L；Actin-related Protein 2/3 complex subunit 5-like Protein
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9BPX5
-
Expression Region
1-154aa
-
AA Sequence
MSKNTVSSARFRKVDVDEYDENKFVDEEDGGDGQAGPDEGEVDSCLRHSITGNMTAALQAALKNPPINTKSQAVKDRAGSIVLKVLISFKANDIEKAVQSLDKNGVDLLMKYIYKGFESPSDNSSAMLLQWHEKALAAGGVGSIVRVLTARKTV
-
Molecular Weight
16.9 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
ARPC5L, a subunit of the Arp2/3 complex, plays a crucial role in the regulation of actin cytoskeleton dynamics, which is essential for various cellular processes, including cell motility, morphology, and division. Research has shown that ARPC5L is involved in diverse biological functions, such as immune responses, neuronal development, and tissue homeostasis. Its role in cancer progression and metastasis has garnered significant attention, as alterations in actin dynamics can lead to enhanced invasiveness of cancer cells. Given its importance in these physiological and pathological processes, the recombinant expression of ARPC5L provides an essential tool for exploring its structure-function relationship and investigating its potential as a therapeutic target. Researchers aim to produce high-quality recombinant ARPC5L proteins to study their interaction with other cellular components, elucidate the mechanisms underlying actin filament nucleation, and screen for potential inhibitors that could disrupt aberrant signaling pathways associated with cancer and other diseases. Understanding the functional significance of ARPC5L and its associated networks can potentially lead to novel strategies for treating diseases characterized by dysregulated actin dynamics.
