Analytical Data
-
Gene name
C1qL1
- Application
-
Alternative Names
C1qL1；CTRP11；Complement C1q-like Protein 4
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
O75973
-
Expression Region
1-258aa
-
AA Sequence
MLLVLVVLIPVLVSSGGPEGHYEMLGTCRMVCDPYPARGPGAGARTDGGD ALSEQSGAPPPSTLVQGPQGKPGRTGKPGPPGPPGDPGPPGPVGPPGEKG EPGKPGPPGLPGAGGSGAISTATYTTVPRVAFYAGLKNPHEGYEVLKFDD VVTNLGNNYDAASGKFTCNIPGTYFFTYHVLMRGGDGTSMWADLCKNGQV RASAIAQDADQNYDYASNSVILHLDAGDEVFIKLDGGKAHGGNSNKYSTF SGFIIYSD
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
C1qL1, a member of the complement system, has garnered attention in recent years due to its crucial role in immune response and its potential implications in various diseases, including autoimmune disorders and cancer. Functioning as a ligand for C1q, C1qL1 is involved in the regulation of phagocytosis and inflammation, acting as a bridge between innate and adaptive immunity. Research has revealed that C1qL1 influences the activation of immune cells and modulates their responses, highlighting its significance in immune homeostasis. Additionally, aberrant expression of C1qL1 has been implicated in pathological conditions, prompting investigations into its potential as a biomarker and therapeutic target. Studies focusing on the structural and functional characterization of C1qL1 recombinant proteins are crucial for understanding their interactions with various immune components and their mechanistic roles in disease pathways. By elucidating the role of C1qL1 in the complement system, researchers aim to pave the way for novel immunotherapeutic strategies and enhance our understanding of immune regulation, particularly in contexts where traditional therapies have been ineffective.
