Analytical Data
-
Gene name
ZFP90
- Application
-
Alternative Names
ZFP90; KIAA1954; ZNF756; Zinc finger Protein 90 homolog; Zfp-90; Zinc finger Protein 756
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q8TF47
-
Expression Region
1-224 aa
-
AA Sequence
MRIHKRGKPYQSSNYSIDFKHSTSLTQDESTLTEVKSYHCNDCGEDFSHITDFTDHQRIHTAENPYDCEQAFSQQAISHPGEKPYQCNVCGKAFKRSTSFIEHHRIHTGEKPYECNECGEAFSRRSSLTQHERTHTGEKPYECIDCGKAFSQSSSLIQHERTHTGEKPYECNECGRAFRKKTNLHDHQRIHTGEKPYSCKECGKNFSRSSALTKHQRIHTRNKL
-
Molecular Weight
52.4 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
ZFP90 is a member of the zinc finger protein family and plays a crucial role in various cellular processes, including transcription regulation, cell differentiation, and stress response. Research into ZFP90 recombinant protein has gained significance due to its potential applications in understanding gene regulation and its implications in diseases, particularly cancer and developmental disorders. The structure of ZFP90, characterized by its zinc finger motifs, facilitates DNA-binding, allowing it to interact with specific gene promoters and modulate transcriptional activity. This makes ZFP90 an important target for studies aimed at elucidating the molecular mechanisms underlying gene expression. Additionally, investigations are focusing on the potential use of ZFP90 in gene therapy and synthetic biology, where it can be engineered to target and regulate specific genes of interest. Furthermore, recombinant ZFP90 protein can serve as a valuable tool for functional assays, aiding researchers in dissecting the pathways and interactions in which ZFP90 is involved. The ongoing studies are expected to provide insights into the therapeutic potential of ZFP90, as well as its role as a biomarker for specific diseases, thus highlighting its importance in both basic and applied biological research.
