Analytical Data
-
Gene name
APOC2
- Application
-
Alternative Names
APOC2；APC2；ApolipoProtein C-II
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P02655
-
Expression Region
23-101aa
-
AA Sequence
TQQPQQDEMPSPTFLTQVKESLSSYWESAKTAAQNLYEKTYLPAVDEKLRDLYSKSTAAMSTYTGIFTDQVLSVLKGEE
-
Molecular Weight
10.9 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
APOC2, or Apolipoprotein C-II, is a crucial protein involved in lipid metabolism, particularly in the regulation of triglyceride-rich lipoproteins. It functions primarily as an activator of lipoprotein lipase (LPL), an enzyme essential for the hydrolysis of triglycerides into free fatty acids, thus playing a key role in lipid homeostasis. The study of APOC2 has gained significant attention in the context of metabolic disorders, including hyperlipidemia and cardiovascular diseases, as alterations in its levels can significantly impact lipid profiles. Furthermore, APOC2 has been implicated in the genetic basis of certain dyslipidemias, making it a target for therapeutic interventions. Research on recombinant APOC2 proteins aims to elucidate its structural and functional characteristics, allowing for a better understanding of its role in lipid metabolism and potential applications in treating related disorders. By producing recombinant APOC2 in various expression systems, scientists can investigate its biochemical properties, interactions with lipoproteins, and effects on LPL activity, contributing to the knowledge required for designing effective lipid-lowering therapies. Additionally, studying the post-translational modifications of APOC2 can provide insights into how these modifications influence its function and interaction with other metabolic pathways. Overall, the research on APOC2 recombinant proteins is pivotal for advancing our understanding of lipid metabolism and developing innovative strategies to manage lipid-related health issues.
