Cat: IPD-X10294

Recombinant Human IL-12R beta 1 Protein (HEK293), C-6*His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    IL-12R beta 1

  • 简介

    IL-12R beta 1 protein is an IL-12 cytokine surface receptor that activates the Jak-Stat signaling cascade pathway and is involved in IL-12-mediated immune regulation. IL-12R beta 1 Protein, Human (HEK293, His) is expressed by HEK293 cells with a C-terminal 6*His tag[1].

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Species

    Human

  • Source

    HEK293

  • Tag

    C-6*His

  • Purity

    > 90% as determined by SDS-PAGE.

  • Uniprot

    P42701

  • Expression Region

    C24-E540

  • AA Sequence

    CRTSECCFQDPPYPDADSGSASGPRDLRCYRISSDRYECSWQYEGPTAGVSHFLRCCLSSGRCCYFAAGSATRLQFSDQAGVSVLYTVTLWVESWARNQTEKSPEVTLQLYNSVKYEPPLGDIKVSKLAGQLRMEWETPDNQVGAEVQFRHRTPSSPWKLGDCGPQDDDTESCLCPLEMNVAQEFQLRRRQLGSQGSSWSKWSSPVCVPPENPPQPQVRFSVEQLGQDGRRRLTLKEQPTQLELPEGCQGLAPGTEVTYRLQLHMLSCPCKAKATRTLHLGKMPYLSGAAYNVAVISSNQFGPGLNQTWHIPADTHTEPVALNISVGTNGTTMYWPARAQSMTYCIEWQPVGQDGGLATCSLTAPQDPDPAGMATYSWSRESGAMGQEKCYYITIFASAHPEKLTLWSTVLSTYHFGGNASAAGTPHHVSVKNHSLDSVSVDWAPSLLSTCPGVLKEYVVRCRDEDSKQVSEHPVQPTETQVTLSGLRAGVAYTVQVRADTAWLRGVWSQPQRFSIE

  • Protein Length

    Partial

  • Molecular Weight

    80-110 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

Interleukin-12 receptor beta 1 (IL-12Rβ1) is a critical component of the IL-12 receptor complex, which plays a pivotal role in the immune response by mediating the effects of interleukin-12 (IL-12) on T and natural killer (NK) cells. The significance of IL-12Rβ1 in immunoregulation and its involvement in various immune-mediated diseases, such as autoimmune disorders and cancer, has sparked considerable research interest. Deficiencies or dysfunctions in IL-12Rβ1 have been linked to increased susceptibility to infectious diseases, as well as to altered responses in cancer immunotherapy. Recombinant IL-12Rβ1 protein studies aim to elucidate its structure, function, and interaction with IL-12, offering insights into therapeutic strategies to modulate the immune system. Understanding the signaling pathways activated by IL-12Rβ1 can help develop novel immunotherapies targeting this receptor to enhance anti-tumor responses or restore immune function in deficient populations. The production and characterization of recombinant IL-12Rβ1 also pave the way for potential diagnostic applications and the development of biomolecules that can either mimic or block its activity, further expanding the frontiers of immunological research and clinical interventions. 

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US