Cat: IPD-X10453

Recombinant Mouse IL-17RB Protein (HEK293), C-6*His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    IL-17RB

  • 简介

    IL-17RB (Interleukin 17 receptor B), a protein encoded by the IL17RB gene, is a receptor for the pro-inflammatory cytokines IL17B and IL17E. IL-17RB expression is high in kidney, pancreas, liver, brain, and intestines. IL-17RB may play a role in hematopoietic cell differentiation and growth. IL-17RB is involved in inflammatory diseases and cancers[1][2]. IL-17RB Protein, Mouse (HEK293, His) is produced in HEK293 cells with six C-Terminal His-tags. It consists of 269 amino acids (R18-G286).

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    Interleukin-17 receptor B; IL-17RB; IL-17Rh1; IL-17B receptor; CRL4; EVI27

  • Species

    Mouse

  • Source

    HEK293

  • Tag

    C-6*His

  • Purity

    > 90% as determined by SDS-PAGE.

  • Uniprot

    Q9JIP3

  • Expression Region

    R18-G286

  • AA Sequence

    REPTIQCGSETGPSPEWMVQHTLTPGDLRDLQVELVKTSVAAEEFSILMNISWILRADASIRLLKATKICVSGKNNMNSYSCVRCNYTEAFQSQTRPSGGKWTFSYVGFPVELSTLYLISAHNIPNANMNEDSPSLSVNFTSPGCLNHVMKYKKQCTEAGSLWDPDITACKKNEKMVEVNFTTNPLGNRYTILIQRDTTLGFSRVLENKLMRTSVAIPVTEESEGAVVQLTPYLHTCGNDCIRREGTVVLCSETSAPIPPDDNRRMLGG

  • Protein Length

    Extracellular Domain

  • Molecular Weight

    38-45 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

Interleukin-17 receptor B (IL-17RB) plays a crucial role in the immune response, particularly in defense against various pathogens and in the pathogenesis of inflammatory diseases. Discovered as a receptor for IL-25 (also known as IL-17E), IL-17RB is predominantly expressed in epithelial cells and immune cells, indicating its significant function in mucosal immunity. Its activation triggers downstream signaling pathways, leading to the production of pro-inflammatory cytokines, growth factors, and chemokines, which are vital for recruiting eosinophils and other inflammatory cells to sites of inflammation. Given its central role in mediating Th2-type immune responses, IL-17RB has emerged as a potential therapeutic target for allergic diseases, asthma, and other Th2-mediated conditions. Recent studies have also highlighted its involvement in various cancers, making it a candidate for further research in tumor immunology. The development of recombinant IL-17RB proteins aims to better understand its biological functions and therapeutic potential by enabling researchers to explore its signaling mechanisms, binding affinities, and interactions with other immune modulators. These advancements could pave the way for innovative treatments for IL-17RB-related diseases and enhance our understanding of its role in both protective immunity and pathological inflammation.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US