Analytical Data
-
Gene name
KCIP-1
-
简介
KCIP-1 protein serves as the linker of TNFRSF1A/TNFR1 and mediates its interaction with FADD. Overexpression induces TNF-induced responses: apoptosis and NF-κ-B activation. KCIP-1 Protein, Mouse (P.pastoris, His) is the recombinant mouse-derived KCIP-1 protein, expressed by P. pastoris , with N-6*His labeled tag.
- Application
-
Alternative Names
Ywhab; 14-3-3 protein beta/alpha; Protein kinase C inhibitor protein 1; KCIP-1
-
Species
Mouse
-
Source
P. pastoris
-
Tag
N-6*His
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9CQV8-1
-
Expression Region
M1-N246
-
AA Sequence
MTMDKSELVQKAKLAEQAERYDDMAAAMKAVTEQGHELSNEERNLLSVAYKNVVGARRSSWRVISSIEQKTERNEKKQQMGKEYREKIEAELQDICNDVLELLDKYLILNATQAESKVFYLKMKGDYFRYLSEVASGENKQTTVSNSQQAYQEAFEISKKEMQPTHPIRLGLALNFSVFYYEILNSPEKACSLAKTAFDEAIAELDTLNEESYKDSTLIMQLLRDNLTLWTSENQGDEGDAGEGEN
-
Protein Length
Full Length of Isoform-1
-
Molecular Weight
33 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
KCIP-1, a novel recombinant protein, has emerged as a significant subject of research due to its potential implications in cellular processes and disease mechanisms. Identified as a member of a unique protein family, KCIP-1 has been implicated in regulating various biological pathways, including cell proliferation, differentiation, and apoptosis. Its distinct structural features, including specific domain arrangements, suggest potential interactions with a range of molecular partners, which could elucidate its functional roles in vivo. Recent studies have highlighted KCIP-1's involvement in oncogenesis, where its expression levels correlate with tumor progression and patient prognosis, underscoring its potential as a biomarker or therapeutic target. Moreover, the recombinant production of KCIP-1 has enabled detailed investigations into its biophysical properties and mechanisms of action, facilitating the exploration of its role in modulating signal transduction pathways and gene expression. Given the increasing interest in protein-based therapeutics, understanding KCIP-1's function and regulatory mechanisms may pave the way for novel intervention strategies in cancer and other diseases. Thus, ongoing research aims to clarify its biological significance and therapeutic potential, marking KCIP-1 as a critical focus in protein science and biomedical research.











