Analytical Data
-
Gene name
CENPH
- Application
-
Alternative Names
CENPH；ICEN35；Centromere Protein H
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9H3R5
-
Expression Region
136-247aa
-
AA Sequence
MGSSHHHHHHSSGLVPRGSHMLNKLIMKSQQESWDLEEKLLDI RKKRL QLKQASESKLLEIQTEKNKQKIDLDSMENSERIKIIRQNLQMEIK ITT VIQHVFQNLILGSKVNWAEDPALKEIVLQLEKNVDMM
-
Molecular Weight
16 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
CENPH, or Centromere Protein H, plays a crucial role in the assembly and function of the centromere, a key region of chromosomes that is essential for proper segregation during cell division. Recent studies have highlighted its importance in maintaining genomic stability, as dysfunctions in centromere proteins, including CENPH, are associated with various diseases, including cancer. The interest in CENPH recombinant proteins has surged, driven by the need to better understand centromeric dynamics and their implications in cellular processes. By producing CENPH as a recombinant protein, researchers can study its structural and functional properties in detail, elucidating its interactions with other centromere-associated proteins and its role in kinetochore formation. Additionally, this research opens avenues for potential therapeutic strategies aimed at correcting anomalies associated with centromere dysfunctions. Understanding the mechanisms by which CENPH operates not only sheds light on fundamental biological processes but also contributes to the development of novel approaches in cancer treatment and genetic research. The exploration of CENPH's biochemical characteristics through recombinant technology ultimately represents a significant step toward unraveling the complexities of chromosome behavior and stability in human cells.
