Analytical Data
-
Gene name
RAB27A
- Application
-
Alternative Names
TBC1D10B;TBC1 domain family member 10B
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P51159
-
Expression Region
2-221aa
-
AA Sequence
SDGDYDYLIKFLALGDSGVGKTSVLYQYTDGKFNSKFITTVGIDFREKRVVYRASGPDGATGRGQRIHLQLWDTAGQERFRSLTTAFFRDAMGFLLLFDLTNEQSFLNVRNWISQLQMHAYCENPDIVLCGNKSDLEDQRVVKEEEAIALAEKYGIPYFETSAANGTNISQAIEMLLDLIMKRMERCVDKSWIPEGVVRSNGHASTDQLSEEKEKGACGC
-
Molecular Weight
26.2 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
RAB27A is a member of the RAB family of small GTPases, which are critical regulators of intracellular vesicle trafficking. It plays a key role in exocytosis, particularly in the transport of secretory lysosomes in various cell types, including melanocytes and cytotoxic T lymphocytes. Dysfunctional RAB27A has been associated with several human diseases, including Griscelli syndrome, a rare genetic disorder characterized by immunological defects and pigmentary abnormalities due to impaired melanin transfer. The study of RAB27A recombinant protein is pivotal for understanding its molecular mechanisms and interactions within cellular pathways. Researchers have increasingly focused on RAB27A to explore its potential as a therapeutic target for conditions related to dysfunctional vesicle trafficking, such as cancer and neurological disorders. The recombinant protein allows for detailed analysis of its structure, function, and regulatory mechanisms, facilitating the development of potential intervention strategies. Enhanced insights into RAB27A may also provide novel biomarkers for disease progression and treatment responses. Thus, ongoing investigations into the properties and functionalities of RAB27A recombinant protein hold promise for advancing our understanding of vesicle transport processes and their implications in health and disease.
