Cat: PA2000-9536

Recombinant Human MTP18 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    MTP18

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    HSPC 242; HSPC242; Mitochondrial 18 kDa protein; Mitochondrial fission process protein 1; Mitochondrial fission protein MTP18; Mitochondrial protein 18 kDa; MTFP1; MTFP1_HUMAN; MTP 18; MTP18

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q9UDX5

  • Expression Region

    1-166 aa

  • AA Sequence

    MSEPQPRGAERDLYRDTWVRYLGYANEVGEAFRSLVPAAVVWLSYGVASSYVLADAIDKGKKAGEVPSPEAGRSARVTVAVVDTFVWQALASVAIPGFTINRVCAASLYVLGTATRWPLAVRKWTTTALGLLTIPIIIHPIDRSVDFLLDSSLRKLYPTVGKPSSS

  • Molecular Weight

    45 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

MTP18, or mitochondrial fom-18 protein, has garnered attention in recent years due to its crucial role in mitochondrial dynamics and function. As a key player in maintaining mitochondrial homeostasis, MTP18 is involved in various cellular processes, including apoptosis, energy metabolism, and oxidative stress response. Research indicates that dysregulation of MTP18 can lead to mitochondrial dysfunction, contributing to a range of diseases, particularly neurodegenerative disorders and metabolic syndromes. Consequently, understanding the structure and function of MTP18 at the molecular level is vital for elucidating its role in health and disease. Studies focusing on the recombinant expression of MTP18 have enabled researchers to investigate its biochemical properties and interactions. Furthermore, the availability of purified MTP18 as a recombinant protein facilitates in-depth studies on its contributions to mitochondrial dynamics and its potential as a therapeutic target. As mitochondrial dysfunction remains a significant concern in aging and various pathologies, unraveling the mechanisms by which MTP18 operates is essential for developing novel strategies for intervention and treatment of related diseases.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US