Analytical Data
-
Gene name
HDAC11
- Application
-
Alternative Names
HDAC11；Histone deacetylase 11
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q96DB2
-
Expression Region
1-347aa
-
AA Sequence
MLHTTQLYQHVPETRWPIVYSPRYNITFMGLEKLHPFDAGKWGKVINFLK EEKLLSDSMLVEAREASEEDLLVVHTRRYLNELKWSFAVATITEIPPVIF LPNFLVQRKVLRPLRTQTGGTIMAGKLAVERGWAINVGGGFHHCSSDRGG GFCAYADITLAIKFLFERVEGISRATIIDLDAHQGNGHERDFMDDKRVYI MDVYNRHIYPGDRFAKQAIRRKVELEWGTEDDEYLDKVERNIKKSLQEHL PDVVVYNAGTDILEGDRLGGLSISPAGIVKRDELVFRMVRGRRVPILMVT SGGYQKRTARIIADSILNLFGLGLIGPESPSVSAQNSDTPLLPPAVP
-
Molecular Weight
66 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
HDAC11 (Histone Deacetylase 11) is a member of the histone deacetylase family, which plays a crucial role in the regulation of gene expression through the modification of chromatin structure. As the only class II histone deacetylase, HDAC11 is unique in its ability to selectively deacetylate lysine residues on histones and non-histone proteins, influencing various cellular processes such as cell cycle regulation, differentiation, and apoptosis. Recent studies have highlighted the potential involvement of HDAC11 in immune responses and inflammation, as well as its correlation with certain diseases, including cancer and neurodegenerative disorders. However, the functional and mechanistic complexities of HDAC11 have prompted researchers to investigate its biochemical properties further. The production of recombinant HDAC11 proteins has become a key focus, allowing scientists to study its enzymatic activities, interactions with other proteins, and the impact of specific inhibitors. Understanding the structure-function relationship of HDAC11 through recombinant protein studies can provide valuable insights into its biological roles and therapeutic potential, paving the way for novel intervention strategies targeting HDAC11 in disease contexts. Overall, HDAC11 represents a promising area of research in epigenetics, with implications for both basic biology and clinical applications.
