Analytical Data
-
Gene name
OR4F15
- Application
-
Alternative Names
OR4F15; Olfactory receptor 4F15; Olfactory receptor OR15-14
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q8NGB8
-
Expression Region
1-312 aa
-
AA Sequence
MNGMNHSVVSEFVFMGLTNSREIQLLLFVFSLLFYFASMMGNLVIVFTVTMDAHLHSPMY FLLANLSIIDMAFCSITAPKMICDIFKKHKAISFRGCITQIFFSHALGGTEMVLLIAMAF DRYMAICKPLHYLTIMSPRMCLYFLATSSIIGLIHSLVQLVFVVDLPFCGPNIFDSFYCD LPRLLRLACTNTQELEFMVTVNSGLISVGSFVLLVISYIFILFTVWKHSSGGLAKALSTL SAHVTVVILFFGPLMFFYTWPSPTSHLDKYLAIFDAFITPFLNPVIYTFRNKDMKVAMRR LCSRLAHFTKIL
-
Molecular Weight
35.3 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
OR4F15 is a member of the olfactory receptor (OR) gene family, which plays a crucial role in the sensory perception of smell. The olfactory receptor genes are highly diverse and represent one of the largest gene families in mammals. OR4F15, specifically, is located on chromosome 14 and is thought to be involved in the detection of various odors, contributing to the complex sense of smell in humans. Its study has gained significance due to the potential implications in understanding olfactory signaling pathways and their associations with various physiological and pathological conditions. Furthermore, research into OR4F15 can provide insights into the role of olfactory receptors in human health, including their possible involvement in neurodegenerative diseases, and their significance in cognitive functions. However, due to the challenges in studying integral membrane proteins, obtaining a stable, functional recombinant form of OR4F15 has been a key focus for researchers. By exploring the structure and function of OR4F15 through recombinant protein studies, scientists aim to elucidate its specific odorant binding characteristics, signaling mechanisms, and interactions at a molecular level. This knowledge could pave the way for advancements in biotechnology, including the development of novel odorant-based therapies and the enhancement of bioengineering applications that leverage olfactory receptor functionality. Overall, the study of OR4F15 presents a fascinating intersection of molecular biology, neuroscience, and potential therapeutic innovation, highlighting its importance in both basic research and applied sciences.
