Cat: PA1000-3150

Recombinant Human TCEAL1 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    TCEAL1

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    TCEAL1;SIIR;Transcription elongation factor A Protein-like 1

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q15170-2

  • Expression Region

    1-159aa

  • AA Sequence

    MDKPRKENEEEPQSAPKTDEERPPVEHSPEKQSPEEQSSEEQSSEEEFFP EELLPELLPEMLLSEERPPQEGLSRKDLFEGRPPMEQPPCGVGKHKLEEG SFKERLARSRPQFRGDIHGRNLSNEEMIQAADELEEMKRVRNKLMIMHWK AKRSRPYPILEHHHHHH

  • Molecular Weight

    20 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

TCEAL1 (T-cell leukemia and lymphoma 1) is a member of the TCEAL gene family, which plays a pivotal role in regulating transcription and its associated processes. Research has indicated that TCEAL1 is involved in various biological functions, including cell growth, differentiation, and apoptosis, making it a significant focus in cancer biology, particularly in T-cell malignancies. Dysregulation of TCEAL1 expression has been observed in several cancers, suggesting its potential as a biomarker for tumor progression and a target for therapeutic intervention. The study of TCEAL1 recombinant proteins is essential for understanding its structural and functional properties, as they can provide insights into its role in gene expression regulation and its interactions with other proteins. Additionally, the production of TCEAL1 recombinant proteins facilitates the development of specific antibodies for diagnostic purposes, as well as the exploration of its potential as a therapeutic target. By elucidating the molecular mechanisms underlying its function, researchers aim to uncover novel strategies for cancer treatment and improve the understanding of T-cell-associated diseases. As such, TCEAL1 represents a promising area of research that combines biochemical, genetic, and therapeutic studies to address critical questions in oncology and cellular biology.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US