Analytical Data
-
Gene name
TCEAL1
- Application
-
Alternative Names
TCEAL1；SIIR；Transcription elongation factor A Protein-like 1
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q15170-2
-
Expression Region
1-159aa
-
AA Sequence
MDKPRKENEEEPQSAPKTDEERPPVEHSPEKQSPEEQSSEEQSSEEEFFP EELLPELLPEMLLSEERPPQEGLSRKDLFEGRPPMEQPPCGVGKHKLEEG SFKERLARSRPQFRGDIHGRNLSNEEMIQAADELEEMKRVRNKLMIMHWK AKRSRPYPILEHHHHHH
-
Molecular Weight
20 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
TCEAL1 (T-cell leukemia and lymphoma 1) is a member of the TCEAL gene family, which plays a pivotal role in regulating transcription and its associated processes. Research has indicated that TCEAL1 is involved in various biological functions, including cell growth, differentiation, and apoptosis, making it a significant focus in cancer biology, particularly in T-cell malignancies. Dysregulation of TCEAL1 expression has been observed in several cancers, suggesting its potential as a biomarker for tumor progression and a target for therapeutic intervention. The study of TCEAL1 recombinant proteins is essential for understanding its structural and functional properties, as they can provide insights into its role in gene expression regulation and its interactions with other proteins. Additionally, the production of TCEAL1 recombinant proteins facilitates the development of specific antibodies for diagnostic purposes, as well as the exploration of its potential as a therapeutic target. By elucidating the molecular mechanisms underlying its function, researchers aim to uncover novel strategies for cancer treatment and improve the understanding of T-cell-associated diseases. As such, TCEAL1 represents a promising area of research that combines biochemical, genetic, and therapeutic studies to address critical questions in oncology and cellular biology.
