Analytical Data
-
Gene name
CACNA2D1
- Application
-
Alternative Names
CACNA2D1；Voltage-dependent calcium channel gamma-4 subunit
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P54289
-
Expression Region
577-717aa
-
AA Sequence
KMIDGESGEKTFRTLVKSQDERYIDKGNRTYTWTPVNGTDYSLALVLPTYSFYYIKAKLEETITQARYSETLKPDNFEESGYTFIAPRDYCNDLKISDNNTEFLLNFNEFIDRKTPNNPSCNADLINRVLLDAGFTNELVQ
-
Molecular Weight
32.3kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
CACNA2D1 encodes the alpha-2/delta-1 subunit of voltage-gated calcium channels, which play a critical role in regulating calcium influx into cells, a process that is essential for various physiological functions, including muscle contraction, neurotransmitter release, and gene expression. Research has shown that alterations in the function of these channels can be implicated in several neurological and cardiovascular disorders. The study of CACNA2D1 recombinant proteins has garnered interest as it allows for a deeper understanding of the molecular mechanisms governing calcium channel function and regulation. By producing and characterizing CACNA2D1 recombinant proteins, researchers aim to elucidate the structure-function relationships of this subunit, investigate its interactions with other channel subunits, and explore its potential role in pathophysiological conditions. Furthermore, understanding the specific contributions of CACNA2D1 to calcium channel activity may pave the way for the development of targeted therapies for associated diseases, as well as provide insights into potential therapeutic interventions that can modulate calcium signaling pathways. Overall, the investigation of CACNA2D1 recombinant proteins holds significant promise for advancing our knowledge of calcium channels and their implications in health and disease.
