Cat: PA2000-1918

Recombinant Human Cd68 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    Cd68

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    Cd68;Macrosialin

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P34810

  • Expression Region

    22-319aa

  • AA Sequence

    MGSSHPLHHHSSGLVPRGSHMGSHMNDCPHKKSATLLPSFTVTPTVTEST GTTSHRTTKSHKTTTHRTTTTGTTSHGPTTATHNPTTTSHGNVTVHPTSN STATSQGPSTATHSPATTSHGNATVHPTSNSTATSPGFTSSAHPEPPPPS PSPSPTSKETIGDYTWTNGSQPCVHLQAQIQIRVMYTTQGGGEAWGISVL NPNKTKVQGSCEGAHPHLLLSFPYGHLSFGFMQDLQQKVVYLSYMAVEYN VSFPHAAQWTFSAQNASLRDLQAPLGQSFSCSNSSIILSPAVHLDLLSLR LQAAQLPHTGVFGQSFSCPSDRS

  • Molecular Weight

    34 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

CD68 is a transmembrane glycoprotein predominantly expressed in macrophages and plays a crucial role in immune responses and inflammation. As a marker for monocyte-derived cells, CD68 is integral in the identification and characterization of various macrophage populations in both healthy and diseased tissues. The study of recombinant CD68 proteins enhances our understanding of its function in the immune system, including phagocytosis, antigen presentation, and cytokine secretion. Research has shown that CD68 is involved in the progression of various diseases, including autoimmune disorders, chronic inflammation, and cancer, making it a potential target for therapeutic interventions. The production of recombinant CD68 allows for in-depth investigations into its structure-function relationship and the molecular mechanisms underlying its role in macrophage activation and polarization. Moreover, understanding how CD68 interacts with other proteins and signaling pathways can provide insights into the modulation of macrophage activity in pathological contexts. Overall, the study of recombinant CD68 proteins is significant in elucidating immunological processes and developing novel strategies for disease treatment and management.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US