Analytical Data
-
Gene name
SLC27A2
- Application
-
Alternative Names
SLC27A2；ACSVL1；FACVL1；FATP2；Long-chain fatty acid transport Protein 2
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
O14975
-
Expression Region
283-620aa
-
AA Sequence
GATLALRTKFSASQFWDDCRKYNVTVIQYIGELLRYLCNSPQKPNDRDHKVRLALGNGLRGDVWRQFVKRFGDICIYEFYAATEGNIGFMNYARKVGAVGRVNYLQKKIITYDLIKYDVEKDEPVRDENGYCVRVPKGEVGLLVCKITQLTPFNGYAGAKAQTEKKKLRDVFKKGDLYFNSGDLLMVDHENFIYFHDRVGDTFRWKGENVATTEVADTVGLVDFVQEVNVYGVHVPDHEGRIGMASIKMKENHEFDGKKLFQHIADYLPSYARPRFLRIQDTIEITGTFKHRKMTLVEEGFNPAVIKDALYFLDDTAKMYVPMTEDIYNAISAKTLKL
-
Molecular Weight
40.8 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
SLC27A2, also known as fatty acid transport protein 2 (FATP2), is a member of the solute carrier family of proteins, which play a crucial role in the uptake and transport of long-chain fatty acids across cell membranes. The importance of SLC27A2 is particularly highlighted in the context of various metabolic disorders, including obesity, insulin resistance, and cardiovascular diseases. Mutations in the SLC27A2 gene have been associated with specific genetic disorders, such as infantile hepatic failure and certain types of progressive neurological diseases, indicating its significance in human health. Research involving recombinant SLC27A2 protein is essential for elucidating its functional mechanisms, cellular distribution, and regulatory pathways. Producing the recombinantly expressed protein allows for the study of its structure-function relationships, interaction with various fatty acids, and role in cellular metabolism. Understanding SLC27A2's function can provide insights into the molecular basis of diseases linked to impaired fatty acid transport, opening pathways for therapeutic interventions. Given the increasing prevalence of metabolic syndrome and related conditions, SLC27A2 research is timely and relevant, offering potential targets for drug development and novel approaches to treat metabolic disorders.
