Cat: PA2000-2251

Recombinant Human TK2 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    TK2

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    TK2;Thymidine kinase 2. mitochondrial

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    O00142

  • Expression Region

    34-265aa

  • AA Sequence

    VQRRAWPPDKEQEKEKKSVICVEGNIASGKTTCLEFFSNATDVEVLTEPVSKWRNVRGHNPLGLMYHDASRWGLTLQTYVQLTMLDRHTRPQVSSVRLMERSIHSARYIFVENLYRSGKMPEVDYVVLSEWFDWILRNMDVSVDLIVYLRTNPETCYQRLKKRCREEEKVIPLEYLEAIHHLHEEWLIKGSLFPMAAPVLVIEADHHMERMLELFEQNRDRILTPENRKHCP

  • Molecular Weight

    32.5 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

TK2, or thymidine kinase 2, is a mitochondrial enzyme that plays a crucial role in the salvage pathway of nucleotide metabolism, specifically in the phosphorylation of thymidine to thymidine monophosphate. Research on TK2 has gained significant attention due to its critical involvement in maintaining mitochondrial function and energy production, as well as its implications in various mitochondrial disorders. Mutations in the TK2 gene can lead to a range of myopathies, characterized by muscle weakness, exercise intolerance, and fatigue, often referred to as mitochondrial DNA depletion syndromes. Understanding TK2's structure and function is essential for developing therapeutic strategies for these conditions. Additionally, its potential role in regulating cellular stress responses and apoptosis has opened new avenues in cancer research. Investigating the recombinant expression of TK2 allows for the study of its biochemical and structural properties, facilitating a deeper understanding of its function in health and disease. Moreover, the development of TK2 inhibitors or modulators could lead to novel treatments for diseases linked to mitochondrial dysfunction. Researchers are actively exploring these avenues, employing techniques such as crystallography and molecular dynamics simulations to gain insights into TK2's active site and substrate interactions. Overall, the study of TK2 and its recombinant protein offers significant promise not only for understanding mitochondrial biology but also for developing targeted therapies for a range of diseases associated with mitochondrial dysfunction.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US