Analytical Data
-
Gene name
QSCN6
- Application
-
Alternative Names
QSOX1; QSCN6; UNQ2520/PRO6013; Sulfhydryl oxidase 1; hQSOX; Quiescin Q6
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
O00391
-
Expression Region
81-180 aa
-
AA Sequence
KALAEDVKAWRPALYLAALDCAEETNSAVCRDFNIPGFPTVRFFKAFTKNGSGAVFPVAGADVQTLRERLIDALESHHDTWPPACPPLEPAKLEEIDGFF
-
Molecular Weight
36.74 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
QSCN6, a member of the potassium channel family, plays a crucial role in various physiological processes, including neuronal excitability and muscle contraction. The study of QSCN6 recombinant proteins has gained significant attention due to their potential implications in understanding the underlying mechanisms of cellular signaling and their relevance in pathological conditions. Abnormalities in potassium channel function have been linked to various diseases, such as epilepsy, cardiac arrhythmias, and migraines. By expressing QSCN6 as a recombinant protein, researchers can investigate its electrophysiological properties, interaction with other cellular components, and its role in ion transport. Furthermore, studying the structural and functional characteristics of QSCN6 could provide insights into drug design, potentially leading to novel therapeutic strategies for channelopathies. The development of advanced techniques in protein engineering and expression has facilitated the production of functional QSCN6 proteins, paving the way for in-depth studies on their biophysical attributes and biological significance. Thus, the exploration of QSCN6 as a recombinant protein not only enhances our understanding of potassium channels but also contributes to the broader field of ion channel research and its applications in medicine.
