Analytical Data
-
Gene name
C1orf51
- Application
-
Alternative Names
CIART; C1orf51Circadian-associated transcriptional repressor; ChIP-derived repressor of network oscillator; Chrono; Computationally highlighted repressor of the network oscillator
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q8N365
-
Expression Region
1-385aa
-
AA Sequence
MDSPSSVSSYSSYSLSSSFPTSPVNSDFGFPSDSEREDKGAHGPRPDTVGQRGGSRPSPGPIRCRHRSKVSGNQHTPSHPKQRGSASPMAGSGAKRSRDGELETSLNTQGCTTEGDLLFAQKCKELQGFIPPLTDLLNGLKMGRFERGLSSFQQSVAMDRIQRIVGVLQKPQMGERYLGTLLQVEGMLKTWFPQIAAQKSSLGGGKHQLTKHFPSHHSDSAASSPASPMEKMDQTQLGHLALKPKQPWHLTQWPAMNLTWIHTTPICNPPLSSPGTISFSHGPLGTGTGIGVILFLQHGVQPFTHSAPTTPVPPTTASPVIPGEPMKLSGEGPRCYSLPVTLPSDWSYTLSPPSLPTLARKMTIGHREQQRSHPPVAADAHLLNL
-
Molecular Weight
67.8 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
C1orf51, also known as "Chromosome 1 Open Reading Frame 51," has gained attention in recent years due to its potential role in various biological processes and diseases. Initially identified through genomic studies, C1orf51 is a protein-coding gene located on chromosome 1. Research has suggested its involvement in cellular functions such as cell proliferation, differentiation, and response to stress. Moreover, recent findings indicate that C1orf51 may play a role in the pathogenesis of certain cancers, autoimmune diseases, and neurodegenerative disorders. The protein's structure, which includes specific functional domains, has been linked to its ability to interact with other cellular components, making it a candidate for further functional studies. Given the increasing evidence of its biological significance, researchers have focused on the expression and characterization of recombinant C1orf51 protein. Such studies aim to elucidate its molecular mechanisms and pathways, potentially leading to the identification of novel therapeutic targets. Understanding the role of C1orf51 in disease contexts could provide insights into disease mechanisms and pave the way for innovative treatment strategies. As a result, the investigation of recombinant C1orf51 protein has become an important avenue in biomedical research, with the hope of uncovering new knowledge that could translate into clinical applications.
